Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-P2RX4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit P2RX4 Polyclonal Antibody | anti-P2RX4 antibody

P2RX4 antibody - N-terminal region

Gene Names
P2RX4; P2X4; P2X4R
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
P2RX4; Polyclonal Antibody; P2RX4 antibody - N-terminal region; anti-P2RX4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW
Sequence Length
388
Applicable Applications for anti-P2RX4 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-P2RX4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-P2RX4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-P2RX4 antibody
This is a rabbit polyclonal antibody against P2RX4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: P2RX4 is the receptor for ATP that acts as a ligand gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin.The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants have been identified for this gene although their full-length natures have not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-P2RX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
P2X purinoceptor 4 isoform 2
NCBI Official Synonym Full Names
purinergic receptor P2X 4
NCBI Official Symbol
P2RX4
NCBI Official Synonym Symbols
P2X4; P2X4R
NCBI Protein Information
P2X purinoceptor 4
UniProt Protein Name
P2X purinoceptor 4
Protein Family
UniProt Gene Name
P2RX4
UniProt Synonym Gene Names
P2X4
UniProt Entry Name
P2RX4_HUMAN

NCBI Description

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants, some protein-coding and some not protein-coding, have been found for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

P2X4: Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin. Belongs to the P2X receptor family.

Protein type: Membrane protein, multi-pass; Channel, ligand-gated; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q24.32

Cellular Component: membrane; cell soma; perinuclear region of cytoplasm; apical part of cell; lysosomal membrane; integral to plasma membrane; postsynaptic density; dendritic spine; plasma membrane; terminal button; integral to nuclear inner membrane; cell junction

Molecular Function: protein homodimerization activity; copper ion binding; zinc ion binding; cadherin binding; drug binding; ATP binding; purinergic nucleotide receptor activity; ATP-gated cation channel activity; receptor binding

Biological Process: positive regulation of nitric oxide biosynthetic process; generation of action potential; positive regulation of calcium-mediated signaling; regulation of sodium ion transport; sensory perception of pain; signal transduction; vasodilation; response to ATP; endothelial cell activation; membrane depolarization; transport; calcium ion transport; regulation of blood pressure; positive regulation of prostaglandin secretion; tissue homeostasis; regulation of excitatory postsynaptic membrane potential; positive regulation of calcium ion transport; nitric oxide biosynthetic process; protein homooligomerization

Research Articles on P2RX4

Similar Products

Product Notes

The P2RX4 p2rx4 (Catalog #AAA3202625) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P2RX4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's P2RX4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the P2RX4 p2rx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQLLILAYVI GWVFVWEKGY QETDSVVSSV TTKVKGVAVT NTSKLGFRIW. It is sometimes possible for the material contained within the vial of "P2RX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.