Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VDAC3Sample Type: HT1080Antibody Dilution: 1.0ug/ml)

Rabbit VDAC3 Polyclonal Antibody | anti-VDAC3 antibody

VDAC3 antibody - N-terminal region

Gene Names
VDAC3; VDAC-3; HD-VDAC3
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VDAC3; Polyclonal Antibody; VDAC3 antibody - N-terminal region; anti-VDAC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE
Sequence Length
283
Applicable Applications for anti-VDAC3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VDAC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VDAC3Sample Type: HT1080Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VDAC3Sample Type: HT1080Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: VDAC3Sample Type: RPMI-8226Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VDAC3Sample Type: RPMI-8226Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-VDAC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-VDAC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Thymus)
Related Product Information for anti-VDAC3 antibody
This is a rabbit polyclonal antibody against VDAC3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase and glycerol kinase. VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase (see HK1; MIM 142600) and glycerol kinase (GK; MIM 300474) (Rahmani et al., 1998).[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1413 AF038962.1 2-1414

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
voltage-dependent anion-selective channel protein 3 isoform 1
NCBI Official Synonym Full Names
voltage dependent anion channel 3
NCBI Official Symbol
VDAC3
NCBI Official Synonym Symbols
VDAC-3; HD-VDAC3
NCBI Protein Information
voltage-dependent anion-selective channel protein 3
UniProt Protein Name
Voltage-dependent anion-selective channel protein 3
UniProt Gene Name
VDAC3
UniProt Synonym Gene Names
VDAC-3; hVDAC3
UniProt Entry Name
VDAC3_HUMAN

NCBI Description

This gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kinases of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Alternatively transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

VDAC3: a protein of the eukaryotic mitochondrial porin family. Forms a voltage-dependent anion channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. Two splice-variant isoforms have been described.

Protein type: Channel, misc.; Mitochondrial; Membrane protein, integral

Chromosomal Location of Human Ortholog: 8p11.2

Cellular Component: pore complex; mitochondrial outer membrane; mitochondrion; nucleus

Molecular Function: nucleotide binding; voltage-gated anion channel activity; porin activity

Biological Process: adenine transport; transmembrane transport; anion transport

Research Articles on VDAC3

Similar Products

Product Notes

The VDAC3 vdac3 (Catalog #AAA3202465) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VDAC3 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's VDAC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VDAC3 vdac3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SCSGVEFSTS GHAYTDTGKA SGNLETKYKV CNYGLTFTQK WNTDNTLGTE. It is sometimes possible for the material contained within the vial of "VDAC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.