Western Blot (WB)
(WB Suggested Anti-LGICZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)
Rabbit LGICZ1 Polyclonal Antibody | anti-ZACN antibody
LGICZ1 antibody - N-terminal region
Gene Names
ZACN; L2; ZAC; ZAC1; LGICZ; LGICZ1
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LGICZ1; Polyclonal Antibody; LGICZ1 antibody - N-terminal region; anti-ZACN antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM
Sequence Length
412
Applicable Applications for anti-ZACN antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 100%; Horse: 93%; Human: 100%; Pig: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LGICZ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LGICZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)
Western Blot (WB)
(WB Suggested Anti-LGICZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-ZACN antibody
This is a rabbit polyclonal antibody against LGICZ1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels (Davies et al., 2003 [PubMed 12381728]).[supplied by OMIM].
Target Description: LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels (Davies et al., 2003 [PubMed 12381728]).[supplied by OMIM].
Product Categories/Family for anti-ZACN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
zinc-activated ligand-gated ion channel
NCBI Official Synonym Full Names
zinc activated ion channel
NCBI Official Symbol
ZACN
NCBI Official Synonym Symbols
L2; ZAC; ZAC1; LGICZ; LGICZ1
NCBI Protein Information
zinc-activated ligand-gated ion channel
UniProt Protein Name
Zinc-activated ligand-gated ion channel
Protein Family
UniProt Gene Name
ZACN
UniProt Synonym Gene Names
L2; LGICZ; LGICZ1; ZAC
NCBI Description
LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels (Davies et al., 2003 [PubMed 12381728]).[supplied by OMIM, Mar 2008]
Uniprot Description
Zinc-activated ligand-gated ion channel.
Research Articles on ZACN
Similar Products
Product Notes
The ZACN zacn (Catalog #AAA3202632) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LGICZ1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LGICZ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZACN zacn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSLFNVNLSK KVQESIQIPN NGSAPLLVDV RVFVSNVFNV DILRYTMSSM. It is sometimes possible for the material contained within the vial of "LGICZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
