Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HTR1F Antibody Titration: 2.5ug/mlPositive Control: Human Liver)

Rabbit HTR1F Polyclonal Antibody | anti-HTR1F antibody

HTR1F antibody - N-terminal region

Gene Names
HTR1F; 5HT6; MR77; 5-HT1F; HTR1EL; 5-HT-1F
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
HTR1F; Polyclonal Antibody; HTR1F antibody - N-terminal region; anti-HTR1F antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV
Sequence Length
366
Applicable Applications for anti-HTR1F antibody
Western Blot (WB)
Homology
Cow: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1F
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HTR1F Antibody Titration: 2.5ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-HTR1F Antibody Titration: 2.5ug/mlPositive Control: Human Liver)
Related Product Information for anti-HTR1F antibody
This is a rabbit polyclonal antibody against HTR1F. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The 5-HT1F receptor is present in both human vascular and neuronal tissue. This gene is localized at 3p12.
Product Categories/Family for anti-HTR1F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 1F
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 1F
NCBI Official Symbol
HTR1F
NCBI Official Synonym Symbols
5HT6; MR77; 5-HT1F; HTR1EL; 5-HT-1F
NCBI Protein Information
5-hydroxytryptamine receptor 1F
UniProt Protein Name
5-hydroxytryptamine receptor 1F
UniProt Gene Name
HTR1F
UniProt Synonym Gene Names
HTR1EL; 5-HT-1F; 5-HT1F
UniProt Entry Name
5HT1F_HUMAN

Uniprot Description

5-HT(1F): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p12

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: serotonin binding; serotonin receptor activity

Biological Process: synaptic transmission; G-protein signaling, coupled to cyclic nucleotide second messenger; G-protein signaling, adenylate cyclase inhibiting pathway; serotonin receptor signaling pathway

Research Articles on HTR1F

Similar Products

Product Notes

The HTR1F htr1f (Catalog #AAA3224514) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTR1F antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HTR1F can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HTR1F htr1f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDFLNSSDQN LTSEELLNRM PSKILVSLTL SGLALMTTTI NSLVIAAIIV. It is sometimes possible for the material contained within the vial of "HTR1F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.