Western Blot (WB)
(WB Suggested Anti-RAB3D AntibodyPositive Control: Lane 1: BCAM0379 protein from B cenocepaciaPrimary Antibody Dilution : 1:5000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Katie Nurse)
Rabbit RAB3D Polyclonal Antibody | anti-RAB3D antibody
RAB3D antibody - C-terminal region
Gene Names
RAB3D; GOV; D2-2; RAB16; RAD3D
Reactivity
Cow, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
RAB3D; Polyclonal Antibody; RAB3D antibody - C-terminal region; anti-RAB3D antibody
Host
Rabbit
Reactivity
Cow, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS
Sequence Length
219
Applicable Applications for anti-RAB3D antibody
Western Blot (WB)
Homology
Cow: 86%; Human: 100%; Mouse: 80%; Rabbit: 86%; Rat: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB3D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RAB3D AntibodyPositive Control: Lane 1: BCAM0379 protein from B cenocepaciaPrimary Antibody Dilution : 1:5000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Katie Nurse)
Western Blot (WB)
(WB Suggested Anti-RAB3D AntibodyPositive Control: Lane 1: BCAM0379 protein from B cenocepaciaPrimary Antibody Dilution : 1:5000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Katie Nurse)
Western Blot (WB)
(WB Suggested Anti-RAB3D Antibody Titration: 2.5ug/mlPositive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-RAB3D Antibody Titration: 2.5ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-RAB3D antibody
This is a rabbit polyclonal antibody against RAB3D. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: As a protein transport, RAB3D is probably involved in regulated exocytosis.
Target Description: As a protein transport, RAB3D is probably involved in regulated exocytosis.
Product Categories/Family for anti-RAB3D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ras-related protein Rab-3D
NCBI Official Synonym Full Names
RAB3D, member RAS oncogene family
NCBI Official Symbol
RAB3D
NCBI Official Synonym Symbols
GOV; D2-2; RAB16; RAD3D
NCBI Protein Information
ras-related protein Rab-3D
UniProt Protein Name
Ras-related protein Rab-3D
Protein Family
UniProt Gene Name
RAB3D
UniProt Synonym Gene Names
GOV; RAB16
UniProt Entry Name
RAB3D_HUMAN
Uniprot Description
RAB3D: Protein transport. Probably involved in regulated exocytosis. Belongs to the small GTPase superfamily. Rab family.
Protein type: G protein, monomeric; G protein, monomeric, Rab
Chromosomal Location of Human Ortholog: 19p13.2
Cellular Component: synaptic vesicle; transport vesicle; mitochondrion; secretory granule membrane; plasma membrane; endosome
Molecular Function: GTPase activity; GTPase binding; GDP binding; GTP binding; myosin V binding
Biological Process: regulation of exocytosis; intracellular protein transport; synaptic vesicle exocytosis; protein secretion; peptidyl-cysteine methylation; Rab protein signal transduction; vesicle docking during exocytosis
Research Articles on RAB3D
Similar Products
Product Notes
The RAB3D rab3d (Catalog #AAA3224508) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB3D antibody - C-terminal region reacts with Cow, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAB3D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB3D rab3d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KENINVKQVF ERLVDVICEK MNESLEPSSS SGSNGKGPAV GDAPAPQPSS. It is sometimes possible for the material contained within the vial of "RAB3D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
