Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BLK Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Rabbit BLK Polyclonal Antibody | anti-BLK antibody

BLK antibody - middle region

Gene Names
BLK; MODY11
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
BLK; Polyclonal Antibody; BLK antibody - middle region; anti-BLK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY
Sequence Length
505
Applicable Applications for anti-BLK antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BLK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BLK Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-BLK Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-BLK antibody
This is a rabbit polyclonal antibody against BLK. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BLK may function in a signal transduction pathway that is restricted to B-lymphoid cells.
Product Categories/Family for anti-BLK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
640
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
tyrosine-protein kinase Blk isoform 1
NCBI Official Synonym Full Names
BLK proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
BLK
NCBI Official Synonym Symbols
MODY11
NCBI Protein Information
tyrosine-protein kinase Blk
UniProt Protein Name
Tyrosine-protein kinase Blk
Protein Family
UniProt Gene Name
BLK
UniProt Entry Name
BLK_HUMAN

NCBI Description

This gene encodes a nonreceptor tyrosine-kinase of the src family of proto-oncogenes that are typically involved in cell proliferation and differentiation. The protein has a role in B-cell receptor signaling and B-cell development. The protein also stimulates insulin synthesis and secretion in response to glucose and enhances the expression of several pancreatic beta-cell transcription factors. [provided by RefSeq, Aug 2010]

Uniprot Description

BLK: a nonreceptor tyrosine kinase of the Src family. Expressed predominantly in B lymphocytes

Protein type: Protein kinase, TK; Protein kinase, tyrosine (non-receptor); Kinase, protein; EC 2.7.10.2; TK group; Src family

Chromosomal Location of Human Ortholog: 8p23-p22

Cellular Component: extrinsic to internal side of plasma membrane

Molecular Function: protein binding; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; ATP binding; receptor binding

Biological Process: B cell receptor signaling pathway; innate immune response; positive regulation of insulin secretion; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of cell proliferation; T cell differentiation

Disease: Maturity-onset Diabetes Of The Young, Type 11

Research Articles on BLK

Similar Products

Product Notes

The BLK blk (Catalog #AAA3208028) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BLK antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BLK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BLK blk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVVTKEPIYI VTEYMARGCL LDFLKTDEGS RLSLPRLIDM SAQIAEGMAY. It is sometimes possible for the material contained within the vial of "BLK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.