Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HIGD2ASample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human HIGD2A Polyclonal Antibody | anti-HIGD2A antibody

HIGD2A Antibody - N-terminal region

Gene Names
HIGD2A; RCF1b
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HIGD2A; Polyclonal Antibody; HIGD2A Antibody - N-terminal region; anti-HIGD2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGN
Sequence Length
106
Applicable Applications for anti-HIGD2A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIGD2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HIGD2ASample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HIGD2ASample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HIGD2A antibody
This is a rabbit polyclonal antibody against HIGD2A. It was validated on Western Blot

Target Description: HIGD2A is a proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. It may be involved in cytochrome c oxidase activity. It may play a role in the assembly of respiratory supercomplexes.
Product Categories/Family for anti-HIGD2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
HIG1 domain family member 2A, mitochondrial
NCBI Official Synonym Full Names
HIG1 hypoxia inducible domain family member 2A
NCBI Official Symbol
HIGD2A
NCBI Official Synonym Symbols
RCF1b
NCBI Protein Information
HIG1 domain family member 2A, mitochondrial
UniProt Protein Name
HIG1 domain family member 2A, mitochondrial
Protein Family
UniProt Gene Name
HIGD2A
UniProt Synonym Gene Names
RCF1b
UniProt Entry Name
HIG2A_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016]

Uniprot Description

HIGD2A: Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May be involved in cytochrome c oxidase activity. May play a role in the assembly of respiratory supercomplexes. Associates with cytochrome c oxidase (COX, complex IV); proposed complex component

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q35.2

Cellular Component: mitochondrial inner membrane; integral to membrane

Biological Process: negative regulation of apoptosis

Research Articles on HIGD2A

Similar Products

Product Notes

The HIGD2A higd2a (Catalog #AAA3218523) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIGD2A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HIGD2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIGD2A higd2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGLSPTVYRN PESFKEKFVR KTRENPVVPI GCLATAAALT YGLYSFHRGN. It is sometimes possible for the material contained within the vial of "HIGD2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.