Western Blot (WB)
(Host: RabbitTarget Name: HIGD1ASample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human HIGD1A Polyclonal Antibody | anti-HIGD1A antibody
HIGD1A Antibody - N-terminal region
Gene Names
HIGD1A; HIG1; RCF1a
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HIGD1A; Polyclonal Antibody; HIGD1A Antibody - N-terminal region; anti-HIGD1A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTGVSLPSYEEDQGSKLIRKAKEAPFVPVGIAGFAAIVAYGLYKLKSRGN
Sequence Length
107
Applicable Applications for anti-HIGD1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of Human HIGD1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HIGD1ASample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HIGD1ASample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HIGD1A antibody
Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May play a role in the assembly of respiratory supercomplexes.
Product Categories/Family for anti-HIGD1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12 kDa
NCBI Official Full Name
HIG1 domain family member 1A, mitochondrial isoform a
NCBI Official Synonym Full Names
HIG1 hypoxia inducible domain family member 1A
NCBI Official Symbol
HIGD1A
NCBI Official Synonym Symbols
HIG1; RCF1a
NCBI Protein Information
HIG1 domain family member 1A, mitochondrial
UniProt Protein Name
HIG1 domain family member 1A, mitochondrial
Protein Family
UniProt Gene Name
HIGD1A
UniProt Synonym Gene Names
HIG1; RCF1a
UniProt Entry Name
HIG1A_HUMAN
Uniprot Description
HIGD1A: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 3p22.1
Cellular Component: protein complex; mitochondrial inner membrane; integral to membrane
Biological Process: cellular response to glucose starvation; negative regulation of apoptosis
Research Articles on HIGD1A
Similar Products
Product Notes
The HIGD1A higd1a (Catalog #AAA3222095) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIGD1A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HIGD1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIGD1A higd1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTGVSLPSYE EDQGSKLIRK AKEAPFVPVG IAGFAAIVAY GLYKLKSRGN. It is sometimes possible for the material contained within the vial of "HIGD1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
