Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)

Mouse anti-Human SDHD Monoclonal Antibody | anti-SDHD antibody

SDHD (SDH4, Succinate Dehydrogenase [Ubiquinone] Cytochrome B Small Subunit, Mitochondrial, CII-4, QPs3, Succinate Dehydrogenase Complex Subunit D, Succinate-ubiquinone Oxidoreductase Cytochrome b Small Subunit, Succinate-ubiquinone Reductase Membrane Anc

Gene Names
SDHD; PGL; CBT1; CWS3; PGL1; QPs3; SDH4; cybS; CII-4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SDHD; Monoclonal Antibody; SDHD (SDH4; Succinate Dehydrogenase [Ubiquinone] Cytochrome B Small Subunit; Mitochondrial; CII-4; QPs3; Succinate Dehydrogenase Complex Subunit D; Succinate-ubiquinone Oxidoreductase Cytochrome b Small Subunit; Succinate-ubiquinone Reductase Membrane Anc; anti-SDHD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F4
Specificity
Recognizes human SDHD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1329
Applicable Applications for anti-SDHD antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa57-161 from human SDHD (AAH09574) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL**
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.55kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)
Related Product Information for anti-SDHD antibody
Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane. Mutations in SDHD have been linked to hereditary paraganglioma.
Product Categories/Family for anti-SDHD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens succinate dehydrogenase complex, subunit D, integral membrane protein, mRNA
NCBI Official Synonym Full Names
succinate dehydrogenase complex subunit D
NCBI Official Symbol
SDHD
NCBI Official Synonym Symbols
PGL; CBT1; CWS3; PGL1; QPs3; SDH4; cybS; CII-4
NCBI Protein Information
succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
Protein Family

NCBI Description

This gene encodes a member of complex II of the respiratory chain, which is responsible for the oxidation of succinate. The encoded protein is one of two integral membrane proteins anchoring the complex to the matrix side of the mitochondrial inner membrane. Mutations in this gene are associated with the formation of tumors, including hereditary paraganglioma. Transmission of disease occurs almost exclusively through the paternal allele, suggesting that this locus may be maternally imprinted. There are pseudogenes for this gene on chromosomes 1, 2, 3, 7, and 18. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]

Research Articles on SDHD

Similar Products

Product Notes

The SDHD (Catalog #AAA6149556) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SDHD (SDH4, Succinate Dehydrogenase [Ubiquinone] Cytochrome B Small Subunit, Mitochondrial, CII-4, QPs3, Succinate Dehydrogenase Complex Subunit D, Succinate-ubiquinone Oxidoreductase Cytochrome b Small Subunit, Succinate-ubiquinone Reductase Membrane Anc reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SDHD can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SDHD for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SDHD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.