Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GNMT expression in transfected 293T cell line by GNMT polyclonal antibody. Lane 1: GNMT transfected lysate (32.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human GNMT Polyclonal Antibody | anti-GNMT antibody

GNMT (Glycine N-methyltransferase) (PE)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GNMT; Polyclonal Antibody; GNMT (Glycine N-methyltransferase) (PE); anti-GNMT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GNMT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GNMT antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GNMT, aa1-295 (NP_061833.1).
Immunogen Sequence
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GNMT expression in transfected 293T cell line by GNMT polyclonal antibody. Lane 1: GNMT transfected lysate (32.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GNMT expression in transfected 293T cell line by GNMT polyclonal antibody. Lane 1: GNMT transfected lysate (32.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GNMT antibody
Glycine N-methyltransferase (GNMT) catalyzes the synthesis of N-methylglycine (sarcosine) from glycine using S-adenosylmethionine (AdoMet) as the methyl donor. GNMT acts as an enzyme to regulate the ratio of S-adenosylmethionine to S-adenosylhomocysteine (AdoHcy) and participates in the detoxification pathway in liver cells.
Product Categories/Family for anti-GNMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,742 Da
NCBI Official Full Name
glycine N-methyltransferase
NCBI Official Synonym Full Names
glycine N-methyltransferase
NCBI Official Symbol
GNMT
NCBI Protein Information
glycine N-methyltransferase; HEL-S-182mP; epididymis secretory sperm binding protein Li 182mP
UniProt Protein Name
Glycine N-methyltransferase
UniProt Gene Name
GNMT
UniProt Entry Name
GNMT_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. The encoded protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). [provided by RefSeq, Oct 2008]

Uniprot Description

GNMT: Catalyzes the methylation of glycine by using S- adenosylmethionine (AdoMet) to form N-methylglycine (sarcosine) with the concomitant production of S-adenosylhomocysteine (AdoHcy). Possible crucial role in the regulation of tissue concentration of AdoMet and of metabolism of methionine. Defects in GNMT are the cause of glycine N- methyltransferase deficiency (GNMT deficiency); also known as hypermethioninemia. The only clinical abnormalities in patients with this deficiency are mild hepatomegaly and chronic elevation of serum transaminases. Belongs to the class I-like SAM-binding methyltransferase superfamily. Glycine N-methyltransferase family.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Methyltransferase; EC 2.1.1.20

Chromosomal Location of Human Ortholog: 6p12

Cellular Component: cytoplasm

Molecular Function: protein binding; glycine N-methyltransferase activity; glycine binding; folic acid binding

Biological Process: methylation; glycogen metabolic process; S-adenosylmethionine metabolic process; protein modification process; regulation of gluconeogenesis; methionine metabolic process; one-carbon compound metabolic process; protein homotetramerization

Disease: Glycine N-methyltransferase Deficiency

Research Articles on GNMT

Similar Products

Product Notes

The GNMT gnmt (Catalog #AAA6380076) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNMT (Glycine N-methyltransferase) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GNMT gnmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.