Western Blot (WB)
(Host: RabbitTarget Name: PLCB4Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human PLCB4 Polyclonal Antibody | anti-PLCB4 antibody
PLCB4 Antibody - middle region
Gene Names
PLCB4; ARCND2; PI-PLC
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLCB4; Polyclonal Antibody; PLCB4 Antibody - middle region; anti-PLCB4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALAS
Sequence Length
1175
Applicable Applications for anti-PLCB4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PLCB4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PLCB4Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PLCB4Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PLCB4 antibody
The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals in the retina. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PLCB4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
129 kDa
NCBI Official Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform a
NCBI Official Synonym Full Names
phospholipase C beta 4
NCBI Official Symbol
PLCB4
NCBI Official Synonym Symbols
ARCND2; PI-PLC
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
UniProt Protein Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
Protein Family
UniProt Gene Name
PLCB4
UniProt Synonym Gene Names
PLC-beta-4
UniProt Entry Name
PLCB4_HUMAN
NCBI Description
The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals in the retina. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2010]
Research Articles on PLCB4
Similar Products
Product Notes
The PLCB4 plcb4 (Catalog #AAA3220868) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLCB4 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLCB4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLCB4 plcb4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMGIETSDIA DVPSDTSKND KKGKANTAKA NVTPQSSSEL RPTTTAALAS. It is sometimes possible for the material contained within the vial of "PLCB4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
