Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: INS1Lanes :Lane 1: INS1 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Donkey anti-rabbit-HRPSecondary Antibody Dilution :1:1000Gene Name :GNAO1Submitted by :Olivier Costa, Diabetes research center VUB)

Rabbit GNAO1 Polyclonal Antibody | anti-GNAO1 antibody

GNAO1 antibody - N-terminal region

Gene Names
GNAO1; GNAO; NEDIM; EIEE17; HLA-DQB1; G-ALPHA-o
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNAO1; Polyclonal Antibody; GNAO1 antibody - N-terminal region; anti-GNAO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
Sequence Length
354
Applicable Applications for anti-GNAO1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 93%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GNAO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: INS1Lanes :Lane 1: INS1 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Donkey anti-rabbit-HRPSecondary Antibody Dilution :1:1000Gene Name :GNAO1Submitted by :Olivier Costa, Diabetes research center VUB)

Western Blot (WB) (Sample Type: INS1Lanes :Lane 1: INS1 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Donkey anti-rabbit-HRPSecondary Antibody Dilution :1:1000Gene Name :GNAO1Submitted by :Olivier Costa, Diabetes research center VUB)

Western Blot (WB)

(WB Suggested Anti-GNAO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-GNAO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Related Product Information for anti-GNAO1 antibody
This is a rabbit polyclonal antibody against GNAO1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain
Product Categories/Family for anti-GNAO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(o) subunit alpha isoform b
NCBI Official Synonym Full Names
G protein subunit alpha o1
NCBI Official Symbol
GNAO1
NCBI Official Synonym Symbols
GNAO; NEDIM; EIEE17; HLA-DQB1; G-ALPHA-o
NCBI Protein Information
guanine nucleotide-binding protein G(o) subunit alpha
UniProt Protein Name
Guanine nucleotide-binding protein G(o) subunit alpha
UniProt Gene Name
GNAO1
UniProt Entry Name
GNAO_HUMAN

NCBI Description

The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]

Uniprot Description

G-alpha(o): Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Stimulated by RGS14. Interacts with RGS14. G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site. Belongs to the G-alpha family. G(i/o/t/z) subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, heterotrimeric alpha G((i/o/t/z)); G protein; G protein, heterotrimeric

Chromosomal Location of Human Ortholog: 16q13

Cellular Component: neuron projection; plasma membrane; heterotrimeric G-protein complex

Molecular Function: corticotropin-releasing hormone receptor 1 binding; GTPase activity; signal transducer activity; GTP binding; mu-type opioid receptor binding; metal ion binding; G-protein beta/gamma-subunit binding; GTPase activating protein binding; metabotropic serotonin receptor binding

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; response to drug; negative regulation of calcium ion transport; response to hydrogen peroxide; muscle contraction; metabolic process; response to cytokine stimulus; forebrain development; dopamine receptor signaling pathway; response to morphine; locomotory behavior; neurite development; regulation of heart contraction; positive regulation of GTPase activity; aging

Disease: Epileptic Encephalopathy, Early Infantile, 17

Research Articles on GNAO1

Similar Products

Product Notes

The GNAO1 gnao1 (Catalog #AAA3212217) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAO1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNAO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNAO1 gnao1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVVYSNTIQS LAAIVRAMDT LGIEYGDKER KADAKMVCDV VSRMEDTEPF. It is sometimes possible for the material contained within the vial of "GNAO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.