Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Lung )

Rabbit HOXC9 Polyclonal Antibody | anti-HOXC9 antibody

HOXC9 antibody - middle region

Gene Names
HOXC9; HOX3; HOX3B
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
HOXC9; Polyclonal Antibody; HOXC9 antibody - middle region; anti-HOXC9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT
Sequence Length
260
Applicable Applications for anti-HOXC9 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HOXC9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Lung )

Immunohistochemistry (IHC) (Human Lung )

Western Blot (WB)

(Host: RabbitTarget Name: HOXC9Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HOXC9Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-HOXC9 Antibody Titration: 2.5ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-HOXC9 Antibody Titration: 2.5ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-HOXC9 antibody
This is a rabbit polyclonal antibody against HOXC9. It was validated on Western Blot and immunohistochemistry

Target Description: HOXC9 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
homeobox protein Hox-C9
NCBI Official Synonym Full Names
homeobox C9
NCBI Official Symbol
HOXC9
NCBI Official Synonym Symbols
HOX3; HOX3B
NCBI Protein Information
homeobox protein Hox-C9
UniProt Protein Name
Homeobox protein Hox-C9
Protein Family
UniProt Gene Name
HOXC9
UniProt Synonym Gene Names
HOX3B
UniProt Entry Name
HXC9_HUMAN

NCBI Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXC9: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Abd-B homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: anterior/posterior pattern formation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; embryonic skeletal morphogenesis

Research Articles on HOXC9

Similar Products

Product Notes

The HOXC9 hoxc9 (Catalog #AAA3202772) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXC9 antibody - middle region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's HOXC9 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HOXC9 hoxc9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DRAPQTLPSP EADALAGSKH KEEKADLDPS NPVANWIHAR STRKKRCPYT. It is sometimes possible for the material contained within the vial of "HOXC9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.