Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Small intestine, submucosal plexus tissue. Antibody concentration: 10ug/ml)

Rabbit DPYSL3 Polyclonal Antibody | anti-DPYSL3 antibody

DPYSL3 antibody - middle region

Gene Names
DPYSL3; DRP3; ULIP; CRMP4; DRP-3; LCRMP; CRMP-4; ULIP-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
DPYSL3; Polyclonal Antibody; DPYSL3 antibody - middle region; anti-DPYSL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA
Sequence Length
570
Applicable Applications for anti-DPYSL3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DPYSL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Small intestine, submucosal plexus tissue. Antibody concentration: 10ug/ml)

Immunohistochemistry (IHC) (Immunohistochemistry with Small intestine, submucosal plexus tissue. Antibody concentration: 10ug/ml)

Western Blot (WB)

(WB Suggested Anti-DPYSL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-DPYSL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-DPYSL3 antibody
This is a rabbit polyclonal antibody against DPYSL3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.
Product Categories/Family for anti-DPYSL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
dihydropyrimidinase-related protein 3 isoform 2
NCBI Official Synonym Full Names
dihydropyrimidinase like 3
NCBI Official Symbol
DPYSL3
NCBI Official Synonym Symbols
DRP3; ULIP; CRMP4; DRP-3; LCRMP; CRMP-4; ULIP-1
NCBI Protein Information
dihydropyrimidinase-related protein 3
UniProt Protein Name
Dihydropyrimidinase-related protein 3
UniProt Gene Name
DPYSL3
UniProt Synonym Gene Names
CRMP4; DRP3; ULIP; ULIP1; DRP-3; CRMP-4; ULIP-1
UniProt Entry Name
DPYL3_HUMAN

Uniprot Description

CRMP-4: Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration. Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: filamentous actin; extracellular space; growth cone; lamellipodium; cytosol

Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides; phosphoprotein binding; SH3 domain binding

Biological Process: actin crosslink formation; positive regulation of filopodium formation; axon guidance; actin filament bundle formation; response to axon injury; negative regulation of cell migration; pyrimidine base catabolic process; protein homooligomerization

Research Articles on DPYSL3

Similar Products

Product Notes

The DPYSL3 dpysl3 (Catalog #AAA3210533) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPYSL3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DPYSL3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the DPYSL3 dpysl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFDLTTTPKG GTPAGSARGS PTRPNPPVRN LHQSGFSLSG TQVDEGVRSA. It is sometimes possible for the material contained within the vial of "DPYSL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.