Immunohistochemistry (IHC)
(Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-GNAO1 antibody )
Rabbit GNAO1 Polyclonal Antibody | anti-GNAO1 antibody
GNAO1 antibody - middle region
Gene Names
GNAO1; GNAO; NEDIM; EIEE17; HLA-DQB1; G-ALPHA-o
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GNAO1; Polyclonal Antibody; GNAO1 antibody - middle region; anti-GNAO1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
Sequence Length
354
Applicable Applications for anti-GNAO1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GNAO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-GNAO1 antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-GNAO1 antibody )
Western Blot (WB)
(Host: RabbitTarget Name: GNAO1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GNAO1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-GNAO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that GNAO1 is expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-GNAO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that GNAO1 is expressed in 721_B)
Related Product Information for anti-GNAO1 antibody
This is a rabbit polyclonal antibody against GNAO1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.
Target Description: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.
Product Categories/Family for anti-GNAO1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(o) subunit alpha isoform b
NCBI Official Synonym Full Names
G protein subunit alpha o1
NCBI Official Symbol
GNAO1
NCBI Official Synonym Symbols
GNAO; NEDIM; EIEE17; HLA-DQB1; G-ALPHA-o
NCBI Protein Information
guanine nucleotide-binding protein G(o) subunit alpha
UniProt Protein Name
cDNA FLJ31446 fis, clone NT2NE2000909, highly similar to Guanine nucleotide-binding protein G(o) subunit alpha 1
UniProt Entry Name
B3KP89_HUMAN
NCBI Description
The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
Research Articles on GNAO1
Similar Products
Product Notes
The GNAO1 (Catalog #AAA3212218) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAO1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNAO1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GNAO1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CDVVSRMEDT EPFSAELLSA MMRLWGDSGI QECFNRSREY QLNDSAKYYL. It is sometimes possible for the material contained within the vial of "GNAO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
