Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :RCC2Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :RCC2Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit RCC2 Polyclonal Antibody | anti-RCC2 antibody

RCC2 antibody - middle region

Gene Names
RCC2; TD-60
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
RCC2; Polyclonal Antibody; RCC2 antibody - middle region; anti-RCC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT
Sequence Length
522
Applicable Applications for anti-RCC2 antibody
Immunoprecipitation (IP), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RCC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunoprecipitation (IP)

(Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :RCC2Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :RCC2Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunoprecipitation (IP) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :RCC2Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :RCC2Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-RCC2 antibody
This is a rabbit polyclonal antibody against RCC2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.
Product Categories/Family for anti-RCC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
protein RCC2
NCBI Official Synonym Full Names
regulator of chromosome condensation 2
NCBI Official Symbol
RCC2
NCBI Official Synonym Symbols
TD-60
NCBI Protein Information
protein RCC2
UniProt Protein Name
Protein RCC2
Protein Family
UniProt Gene Name
RCC2
UniProt Synonym Gene Names
KIAA1470; TD60
UniProt Entry Name
RCC2_HUMAN

NCBI Description

The protein encoded by this gene is a guanine exchange factor that is active on RalA, a small GTPase. The encoded protein and RalA are both essential for proper kinetochore-microtubule function in early mitosis. This protein has been shown to be a biomarker for colorectal cancer. [provided by RefSeq, Oct 2016]

Uniprot Description

TD-60: Required for completion of mitosis and cytokinesis. May function as a guanine nucleotide exchange factor for the small GTPase RAC1. Binds preferentially to the nucleotide-free form of RAC1. Interacts with microtubules.

Protein type: GEFs, misc.; GEFs; Nucleolus

Chromosomal Location of Human Ortholog: 1p36.13

Cellular Component: microtubule; nucleolus; midbody; cytosol

Molecular Function: protein binding; microtubule binding; Rac GTPase binding

Biological Process: integrin-mediated signaling pathway; focal adhesion formation; mitosis; endosome organization and biogenesis; cell division; negative regulation of focal adhesion formation; positive regulation of attachment of spindle microtubules to kinetochore; mitotic cell cycle; regulation of cell migration

Research Articles on RCC2

Similar Products

Product Notes

The RCC2 rcc2 (Catalog #AAA3213279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RCC2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RCC2 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Researchers should empirically determine the suitability of the RCC2 rcc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIRSLACGKS SIIVAADEST ISWGPSPTFG ELGYGDHKPK SSTAAQEVKT. It is sometimes possible for the material contained within the vial of "RCC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.