Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LRRC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Rabbit LRRC6 Polyclonal Antibody | anti-LRRC6 antibody

LRRC6 antibody - middle region

Gene Names
LRRC6; LRTP; TSLRP; CILD19
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LRRC6; Polyclonal Antibody; LRRC6 antibody - middle region; anti-LRRC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE
Sequence Length
466
Applicable Applications for anti-LRRC6 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LRRC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LRRC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-LRRC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-LRRC6 antibody
This is a rabbit polyclonal antibody against LRRC6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.
Product Categories/Family for anti-LRRC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
protein tilB homolog isoform a
NCBI Official Synonym Full Names
leucine rich repeat containing 6
NCBI Official Symbol
LRRC6
NCBI Official Synonym Symbols
LRTP; TSLRP; CILD19
NCBI Protein Information
protein tilB homolog
UniProt Protein Name
Protein tilB homolog
Protein Family
UniProt Gene Name
LRRC6
UniProt Synonym Gene Names
LRTP; TSLRP
UniProt Entry Name
TILB_HUMAN

NCBI Description

The protein encoded by this gene contains several leucine-rich repeat domains and appears to be involved in the motility of cilia. Defects in this gene are a cause of primary ciliary dyskinesia-19 (CILD19). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 11 and 22. [provided by RefSeq, Apr 2016]

Uniprot Description

LRRC6: Plays a role in motility of cilia. Belongs to the tilb protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 8q24.22

Cellular Component: cytoplasm; cilium

Molecular Function: protein binding

Biological Process: sperm motility; male gonad development

Disease: Ciliary Dyskinesia, Primary, 19

Research Articles on LRRC6

Similar Products

Product Notes

The LRRC6 lrrc6 (Catalog #AAA3211446) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRRC6 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LRRC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LRRC6 lrrc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKTTSDRSRE QTNTRSKHME KLEVDPSKHS FPDVTNIVQE KKHTPRRRPE. It is sometimes possible for the material contained within the vial of "LRRC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.