Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-E2F8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysate)

Rabbit E2F8 Polyclonal Antibody | anti-E2F8 antibody

E2F8 antibody - middle region

Gene Names
E2F8; E2F-8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
E2F8; Polyclonal Antibody; E2F8 antibody - middle region; anti-E2F8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDV
Sequence Length
867
Applicable Applications for anti-E2F8 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human E2F8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-E2F8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-E2F8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysate)
Related Product Information for anti-E2F8 antibody
This is a rabbit polyclonal antibody against E2F8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: E2F transcription factors, such as E2F8, are essential for orchestrating expression of genes required for cell cycle progression and proliferation (Christensen et al., 2005 [PubMed 16179649]).
Product Categories/Family for anti-E2F8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
Transcription factor E2F8
NCBI Official Synonym Full Names
E2F transcription factor 8
NCBI Official Symbol
E2F8
NCBI Official Synonym Symbols
E2F-8
NCBI Protein Information
transcription factor E2F8
UniProt Protein Name
Transcription factor E2F8
Protein Family
UniProt Gene Name
E2F8
UniProt Synonym Gene Names
E2F-8
UniProt Entry Name
E2F8_HUMAN

NCBI Description

This gene encodes a member of a family of transcription factors which regulate the expression of genes required for progression through the cell cycle. The encoded protein regulates progression from G1 to S phase by ensuring the nucleus divides at the proper time. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2012]

Uniprot Description

E2F8: Along with E2F7, inhibitor of E2F-dependent transcription. Binds DNA independently of DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3'. Directly represses E2F1 transcription. Appears to regulate a subset of E2F-dependent genes whose products are required for normal cell cycle progession. Belongs to the E2F/DP family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: transcription factor complex; nucleus

Molecular Function: protein binding; protein homodimerization activity; transcription corepressor activity; transcription factor activity

Biological Process: cell proliferation; transcription, DNA-dependent; positive regulation of DNA endoreduplication; positive regulation of transcription from RNA polymerase II promoter; sprouting angiogenesis; cell cycle comprising mitosis without cytokinesis; negative regulation of transcription from RNA polymerase II promoter; negative regulation of cytokinesis; placenta development

Research Articles on E2F8

Similar Products

Product Notes

The E2F8 e2f8 (Catalog #AAA3208710) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The E2F8 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's E2F8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the E2F8 e2f8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLVAESFFRT PGGPTKPTSS SCMDFEGANK TSLGTLFVPQ RKLEVSTEDV. It is sometimes possible for the material contained within the vial of "E2F8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.