Western Blot (WB)
(Host: RabbitTarget Name: FAP24Sample Type: Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human FAAP24 Polyclonal Antibody | anti-FAAP24 antibody
FAAP24 Antibody - N-terminal
Gene Names
FAAP24; C19orf40
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FAAP24; Polyclonal Antibody; FAAP24 Antibody - N-terminal; anti-FAAP24 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFY
Sequence Length
215
Applicable Applications for anti-FAAP24 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-FAAP24 antibody is: synthetic peptide directed towards the N-terminal of Human FAP24
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FAP24Sample Type: Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FAP24Sample Type: Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FAAP24 antibody
This is a rabbit polyclonal antibody against FAP24. It was validated on Western Blot
Target Description: FAAP24 is a component of the Fanconi anemia (FA) core complex (see MIM 227650), which plays a crucial role in DNA damage response (Ciccia et al., 2007 [PubMed 17289582]).[supplied by OMIM, Mar 2008]
Target Description: FAAP24 is a component of the Fanconi anemia (FA) core complex (see MIM 227650), which plays a crucial role in DNA damage response (Ciccia et al., 2007 [PubMed 17289582]).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-FAAP24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23 kDa
NCBI Official Synonym Full Names
FA core complex associated protein 24
NCBI Official Symbol
FAAP24
NCBI Official Synonym Symbols
C19orf40
NCBI Protein Information
Fanconi anemia core complex-associated protein 24
UniProt Protein Name
Fanconi anemia-associated protein of 24 kDa
Protein Family
UniProt Gene Name
FAAP24
UniProt Synonym Gene Names
C19orf40
UniProt Entry Name
FAP24_HUMAN
NCBI Description
FAAP24 is a component of the Fanconi anemia (FA) core complex (see MIM 227650), which plays a crucial role in DNA damage response (Ciccia et al., 2007 [PubMed 17289582]).[supplied by OMIM, Mar 2008]
Research Articles on FAAP24
Similar Products
Product Notes
The FAAP24 faap24 (Catalog #AAA3220137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAAP24 Antibody - N-terminal reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAAP24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAAP24 faap24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKNPPDDTGP VHVPLGHIVA NEKWRGSQLA QEMQGKIKLI FEDGLTPDFY. It is sometimes possible for the material contained within the vial of "FAAP24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
