Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC7A10Sample Type: Human A549Antibody Dilution: 1.0ug/ml)

Rabbit anti-Human SLC7A10 Polyclonal Antibody | anti-SLC7A10 antibody

SLC7A10 Antibody - C-terminal region

Gene Names
SLC7A10; ASC1; asc-1; HASC-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC7A10; Polyclonal Antibody; SLC7A10 Antibody - C-terminal region; anti-SLC7A10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KCVHRLTESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ
Sequence Length
370
Applicable Applications for anti-SLC7A10 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human SLC7A10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC7A10Sample Type: Human A549Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC7A10Sample Type: Human A549Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SLC7A10Sample Type: Human ACHNAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC7A10Sample Type: Human ACHNAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC7A10 antibody
This is a rabbit polyclonal antibody against SLC7A10. It was validated on Western Blot

Target Description: SLC7A10, in association with 4F2HC (SLC3A2; MIM 158070), mediates high-affinity transport of D-serine and several other neutral amino acids (Nakauchi et al., 2000 [PubMed 10863037]).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-SLC7A10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
asc-type amino acid transporter 1
NCBI Official Synonym Full Names
solute carrier family 7 member 10
NCBI Official Symbol
SLC7A10
NCBI Official Synonym Symbols
ASC1; asc-1; HASC-1
NCBI Protein Information
asc-type amino acid transporter 1
UniProt Protein Name
Asc-type amino acid transporter 1
UniProt Gene Name
SLC7A10
UniProt Synonym Gene Names
ASC1; Asc-1

NCBI Description

SLC7A10, in association with 4F2HC (SLC3A2; MIM 158070), mediates high-affinity transport of D-serine and several other neutral amino acids (Nakauchi et al., 2000 [PubMed 10863037]).[supplied by OMIM, Mar 2008]

Uniprot Description

Sodium-independent, high affinity transport of small neutral D- and L-amino acids. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.

Research Articles on SLC7A10

Similar Products

Product Notes

The SLC7A10 slc7a10 (Catalog #AAA3216761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC7A10 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC7A10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC7A10 slc7a10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KCVHRLTESM THWGQELCFV VYPQDAPEEE ENGPCPPSLL PATDKPSKPQ. It is sometimes possible for the material contained within the vial of "SLC7A10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.