Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SHROOM1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SHROOM1 Polyclonal Antibody | anti-SHROOM1 antibody

SHROOM1 Antibody - C-terminal region

Gene Names
SHROOM1; APXL2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SHROOM1; Polyclonal Antibody; SHROOM1 Antibody - C-terminal region; anti-SHROOM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLPAPREETRLENPATHPVLDQPCGQGLPAPNNSIQGKKVELAARLQKML
Sequence Length
783
Applicable Applications for anti-SHROOM1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human SHROOM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SHROOM1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SHROOM1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SHROOM1 antibody
This is a rabbit polyclonal antibody against SHROOM1. It was validated on Western Blot

Target Description: SHROOM family members play diverse roles in the development of the nervous system and other tissues (Hagens et al., 2006 [PubMed 16615870]).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-SHROOM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
protein Shroom1 isoform 1
NCBI Official Synonym Full Names
shroom family member 1
NCBI Official Symbol
SHROOM1
NCBI Official Synonym Symbols
APXL2
NCBI Protein Information
protein Shroom1
UniProt Protein Name
Protein Shroom1
Protein Family
UniProt Gene Name
SHROOM1
UniProt Synonym Gene Names
APXL2; KIAA1960
UniProt Entry Name
SHRM1_HUMAN

NCBI Description

SHROOM family members play diverse roles in the development of the nervous system and other tissues (Hagens et al., 2006 [PubMed 16615870]).[supplied by OMIM, Mar 2008]

Uniprot Description

SHROOM1: May be involved in the assembly of microtubule arrays during cell elongation. Belongs to the shroom family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Actin-binding

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: microtubule; myosin II complex; cytoplasm

Molecular Function: actin filament binding

Biological Process: actin filament bundle formation; cell morphogenesis

Research Articles on SHROOM1

Similar Products

Product Notes

The SHROOM1 shroom1 (Catalog #AAA3217430) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHROOM1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SHROOM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SHROOM1 shroom1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLPAPREETR LENPATHPVL DQPCGQGLPA PNNSIQGKKV ELAARLQKML. It is sometimes possible for the material contained within the vial of "SHROOM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.