Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CAF1ASample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CHAF1A Polyclonal Antibody | anti-CHAF1A antibody

CHAF1A Antibody - C-terminal region

Gene Names
CHAF1A; CAF1; P150; CAF-1; CAF1B; CAF1P150
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHAF1A; Polyclonal Antibody; CHAF1A Antibody - C-terminal region; anti-CHAF1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENH
Sequence Length
783
Applicable Applications for anti-CHAF1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAF1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CAF1ASample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CAF1ASample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CHAF1A antibody
This is a rabbit polyclonal antibody against CAF1A. It was validated on Western Blot

Target Description: Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-CHAF1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
chromatin assembly factor 1 subunit A
NCBI Official Synonym Full Names
chromatin assembly factor 1 subunit A
NCBI Official Symbol
CHAF1A
NCBI Official Synonym Symbols
CAF1; P150; CAF-1; CAF1B; CAF1P150
NCBI Protein Information
chromatin assembly factor 1 subunit A
UniProt Protein Name
Chromatin assembly factor 1 subunit A
Protein Family
UniProt Gene Name
CHAF1A
UniProt Synonym Gene Names
CAF; CAF1P150; CAF-1 subunit A; CAF-I 150 kDa subunit; CAF-I p150; hp150
UniProt Entry Name
CAF1A_HUMAN

NCBI Description

Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM, Mar 2008]

Uniprot Description

CAF-1A: Core component of the CAF-1 complex, a complex thought to mediate chromatin assembly in DNA replication and DNA repair. Assembles histone octamers onto replicating DNA in vitro. CAF-1 performs the first step of the nucleosome assembly process, bringing newly synthesized histones H3 and H4 to replicating DNA; histones H2A/H2B can bind to this chromatin precursor subsequent to DNA replication to complete the histone octamer. CHAF1A binds to histones H3 and H4. It may play a role in heterochromatin maintenance in proliferating cells by bringing newly synthesized cbx proteins to heterochromatic DNA replication foci. The CCR4-NOT complex functions as general transcription regulation complex. Also involved in vitamin D- coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR- mediated transrepression of the CYP27B1 gene. Homodimer. Part of the CAF-1 complex that contains RBBP4, CHAF1B and CHAF1A. CHAF1A binds directly to CHAF1B. Only minor amounts of RBBP4 are complexed with CHAF1A and CHAF1B in G1 phase. Part of the CCR4-NOT core complex that contains CHAF1A, CHAF1B, CNOT1, CNOT2, CNOT3, CNOT4, CNOT6 and CNOT8. CHAF1A binds directly to PCNA and to CBX1. Binds MBD1. Interacts directly with CBX5 via the PxVxL motif. During DNA replication, it forms a S phase- specific complex that facilitates DNA methylation and histone H3 'Lys-9' methylation during replication-coupled chromatin assembly and is at least composed of the CHAF1A, MBD1 and SETDB1. Component of the WINAC complex, at least composed of SMARCA2, SMARCA4, SMARCB1, SMARCC1, SMARCC2, SMARCD1, SMARCE1, ACTL6A, BAZ1B/WSTF, ARID1A, SUPT16H, CHAF1A and TOP2B. Interacts with CBX5. Belongs to the CHAF1A family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA replication

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: protein complex; nuclear chromatin

Molecular Function: identical protein binding; protein binding; unfolded protein binding; chromatin binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; chromatin assembly; protein complex assembly; cell cycle; DNA repair; DNA replication; DNA replication-dependent nucleosome assembly

Research Articles on CHAF1A

Similar Products

Product Notes

The CHAF1A chaf1a (Catalog #AAA3219474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHAF1A Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHAF1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHAF1A chaf1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPGESLSHSE GDDDDDMGED EDEDDGFFVP HGYLSEDEGV TEECADPENH. It is sometimes possible for the material contained within the vial of "CHAF1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.