Western Blot (WB)
(WB Suggested Anti-ELOVL7 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Rabbit ELOVL7 Polyclonal Antibody | anti-ELOVL7 antibody
ELOVL7 antibody - N-terminal region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ELOVL7; Polyclonal Antibody; ELOVL7 antibody - N-terminal region; anti-ELOVL7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS
Sequence Length
281
Applicable Applications for anti-ELOVL7 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ELOVL7 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ELOVL7 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-ELOVL7 antibody
This is a rabbit polyclonal antibody against ELOVL7. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.
Target Description: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.
Product Categories/Family for anti-ELOVL7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
elongation of very long chain fatty acids protein 7 isoform 1
NCBI Official Synonym Full Names
ELOVL fatty acid elongase 7
NCBI Official Symbol
ELOVL7
NCBI Protein Information
elongation of very long chain fatty acids protein 7
UniProt Protein Name
Elongation of very long chain fatty acids protein 7
Protein Family
UniProt Gene Name
ELOVL7
UniProt Synonym Gene Names
ELOVL FA elongase 7
UniProt Entry Name
ELOV7_HUMAN
Uniprot Description
ELOVL7: Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs. Belongs to the ELO family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; EC 2.3.1.199
Chromosomal Location of Human Ortholog: 5q12.1
Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane
Molecular Function: transferase activity; protein binding
Biological Process: very-long-chain fatty acid biosynthetic process; triacylglycerol biosynthetic process; fatty acid elongation, saturated fatty acid; cellular lipid metabolic process
Research Articles on ELOVL7
Similar Products
Product Notes
The ELOVL7 elovl7 (Catalog #AAA3209694) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELOVL7 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELOVL7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELOVL7 elovl7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAFSDLTSRT VHLYDNWIKD ADPRVEDWLL MSSPLPQTIL LGFYVYFVTS. It is sometimes possible for the material contained within the vial of "ELOVL7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
