Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ELOVL6 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Rabbit ELOVL6 Polyclonal Antibody | anti-ELOVL6 antibody

ELOVL6 antibody - N-terminal region

Gene Names
ELOVL6; FAE; LCE; FACE
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELOVL6; Polyclonal Antibody; ELOVL6 antibody - N-terminal region; anti-ELOVL6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNK
Sequence Length
265
Applicable Applications for anti-ELOVL6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ELOVL6 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Western Blot (WB) (WB Suggested Anti-ELOVL6 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-ELOVL6 antibody
This is a rabbit polyclonal antibody against ELOVL6. It was validated on Western Blot

Target Description: Fatty acid elongases (EC 6.2.1.3), such as ELOVL6, use malonyl-CoA as a 2-carbon donor in the first and rate-limiting step of fatty acid elongation.
Product Categories/Family for anti-ELOVL6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
elongation of very long chain fatty acids protein 6
NCBI Official Synonym Full Names
ELOVL fatty acid elongase 6
NCBI Official Symbol
ELOVL6
NCBI Official Synonym Symbols
FAE; LCE; FACE
NCBI Protein Information
elongation of very long chain fatty acids protein 6
UniProt Protein Name
Elongation of very long chain fatty acids protein 6
UniProt Gene Name
ELOVL6
UniProt Synonym Gene Names
FACE; LCE; ELOVL FA elongase 6; hELO2
UniProt Entry Name
ELOV6_HUMAN

NCBI Description

Fatty acid elongases (EC 6.2.1.3), such as ELOVL6, use malonyl-CoA as a 2-carbon donor in the first and rate-limiting step of fatty acid elongation (Moon et al., 2001 [PubMed 11567032]).[supplied by OMIM, Mar 2008]

Uniprot Description

ELOVL6: Condensing enzyme that catalyzes the synthesis of saturated and monounsaturated fatty acids. Highest activity toward C16:0 acyl-CoAs. Belongs to the ELO family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; EC 2.3.1.199

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to endoplasmic reticulum membrane

Molecular Function: protein binding; transferase activity, transferring groups other than amino-acyl groups

Biological Process: long-chain fatty acid biosynthetic process; triacylglycerol biosynthetic process; cellular lipid metabolic process; fatty acid elongation, saturated fatty acid

Research Articles on ELOVL6

Similar Products

Product Notes

The ELOVL6 elovl6 (Catalog #AAA3216464) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELOVL6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ELOVL6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELOVL6 elovl6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVLTLQEYEF EKQFNENEAI QWMQENWKKS FLFSALYAAF IFGGRHLMNK. It is sometimes possible for the material contained within the vial of "ELOVL6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.