Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ELOVL5Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Rabbit ELOVL5 Polyclonal Antibody | anti-ELOVL5 antibody

ELOVL5 antibody - N-terminal region

Gene Names
ELOVL5; HELO1; SCA38; dJ483K16.1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELOVL5; Polyclonal Antibody; ELOVL5 antibody - N-terminal region; anti-ELOVL5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
Sequence Length
299
Applicable Applications for anti-ELOVL5 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 93%; Goat: 92%; Guinea Pig: 85%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ELOVL5Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ELOVL5Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ELOVL5Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ELOVL5Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ELOVL5Sample Type: JurkatAntibody Dilution: 1.0ug/mlELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (Host: RabbitTarget Name: ELOVL5Sample Type: JurkatAntibody Dilution: 1.0ug/mlELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB)

(Host: RabbitTarget Name: ELOVL5Sample Type: MCF7Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: ELOVL5Sample Type: MCF7Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7)

Western Blot (WB)

(WB Suggested Anti-ELOVL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-ELOVL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)
Related Product Information for anti-ELOVL5 antibody
This is a rabbit polyclonal antibody against ELOVL5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011
Product Categories/Family for anti-ELOVL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
elongation of very long chain fatty acids protein 5 isoform 1
NCBI Official Synonym Full Names
ELOVL fatty acid elongase 5
NCBI Official Symbol
ELOVL5
NCBI Official Synonym Symbols
HELO1; SCA38; dJ483K16.1
NCBI Protein Information
elongation of very long chain fatty acids protein 5
UniProt Protein Name
Elongation of very long chain fatty acids protein 5
UniProt Gene Name
ELOVL5
UniProt Synonym Gene Names
ELOVL2; ELOVL FA elongase 5; hELO1
UniProt Entry Name
ELOV5_HUMAN

NCBI Description

This gene belongs to the ELO family. It is highly expressed in the adrenal gland and testis, and encodes a multi-pass membrane protein that is localized in the endoplasmic reticulum. This protein is involved in the elongation of long-chain polyunsaturated fatty acids. Mutations in this gene have been associated with spinocerebellar ataxia-38 (SCA38). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]

Uniprot Description

ELOVL5: Condensing enzyme that catalyzes the synthesis of monounsaturated and of polyunsaturated very long chain fatty acids Acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. Belongs to the ELO family.

Protein type: Lipid Metabolism - unsaturated fatty acid biosynthesis; EC 2.3.1.199; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: endoplasmic reticulum membrane; membrane; cell soma; endoplasmic reticulum; dendrite; integral to membrane

Molecular Function: protein binding; fatty acid elongase activity

Biological Process: unsaturated fatty acid metabolic process; very-long-chain fatty acid biosynthetic process; linoleic acid metabolic process; unsaturated fatty acid biosynthetic process; triacylglycerol biosynthetic process; cellular lipid metabolic process

Disease: Spinocerebellar Ataxia 38

Research Articles on ELOVL5

Similar Products

Product Notes

The ELOVL5 elovl5 (Catalog #AAA3209566) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELOVL5 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELOVL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELOVL5 elovl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHFDASLSTY FKALLGPRDT RVKGWFLLDN YIPTFICSVI YLLIVWLGPK. It is sometimes possible for the material contained within the vial of "ELOVL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.