Western Blot (WB)
(Host: RabbitTarget Name: EIF3BSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human EIF3B Polyclonal Antibody | anti-EIF3B antibody
EIF3B Antibody - middle region
Gene Names
EIF3B; PRT1; EIF3S9; EIF3-ETA; EIF3-P110; EIF3-P116
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EIF3B; Polyclonal Antibody; EIF3B Antibody - middle region; anti-EIF3B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVP
Sequence Length
873
Applicable Applications for anti-EIF3B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EIF3B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: EIF3BSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: EIF3BSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EIF3B antibody
RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.(Microbial infection) In case of FCV infection, plays a role in the ribosomal termination-reinitiation event leading to the translation of VP2.
Product Categories/Family for anti-EIF3B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99 kDa
NCBI Official Full Name
eukaryotic translation initiation factor 3 subunit B isoform 1
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 3 subunit B
NCBI Official Symbol
EIF3B
NCBI Official Synonym Symbols
PRT1; EIF3S9; EIF3-ETA; EIF3-P110; EIF3-P116
NCBI Protein Information
eukaryotic translation initiation factor 3 subunit B
UniProt Protein Name
Eukaryotic translation initiation factor 3 subunit B
UniProt Gene Name
EIF3B
UniProt Synonym Gene Names
eIF3b
UniProt Entry Name
EIF3B_HUMAN
Uniprot Description
eIF3-eta: eukaryotic translation initiation factor 3 subunit 9. Binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. eIF-3 is composed of at least 12 different subunits.
Protein type: Translation initiation; Translation
Chromosomal Location of Human Ortholog: 7p22.3
Cellular Component: eukaryotic translation initiation factor 3 complex; nucleoplasm; cytoplasm; cytosol
Molecular Function: protein binding; translation initiation factor binding; translation initiation factor activity; nucleotide binding; protein complex scaffold
Biological Process: cellular protein metabolic process; translation; translational initiation; gene expression; formation of translation preinitiation complex; regulation of translational initiation
Research Articles on EIF3B
Similar Products
Product Notes
The EIF3B eif3b (Catalog #AAA3223054) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF3B Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EIF3B eif3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENGDADEPSF SDPEDFVDDV SEEELLGDVL KDRPQEADGI DSVIVVDNVP. It is sometimes possible for the material contained within the vial of "EIF3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
