Western Blot (WB)
(WB Suggested Anti-KIAA0859 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Rabbit EEF1AKNMT Polyclonal Antibody | anti-EEF1AKNMT antibody
EEF1AKNMT Antibody - C-terminal region
Gene Names
EEF1AKNMT; feat; CGI-01; DFNB26; DFNB26M; METTL13; KIAA0859; 5630401D24Rik
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
EEF1AKNMT; Polyclonal Antibody; EEF1AKNMT Antibody - C-terminal region; anti-EEF1AKNMT antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV
Sequence Length
543
Applicable Applications for anti-EEF1AKNMT antibody
Western Blot (WB)
Homology
Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KIAA0859
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-KIAA0859 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-KIAA0859 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-EEF1AKNMT antibody
This is a rabbit polyclonal antibody against KIAA0859. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-EEF1AKNMT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
eEF1A lysine and N-terminal methyltransferase isoform 3
NCBI Official Synonym Full Names
eEF1A lysine and N-terminal methyltransferase
NCBI Official Symbol
EEF1AKNMT
NCBI Official Synonym Symbols
feat; CGI-01; DFNB26; DFNB26M; METTL13; KIAA0859; 5630401D24Rik
NCBI Protein Information
eEF1A lysine and N-terminal methyltransferase; methyltransferase-like protein 13
UniProt Protein Name
Methyltransferase-like protein 13
UniProt Gene Name
METTL13
UniProt Synonym Gene Names
KIAA0859
UniProt Entry Name
MET13_HUMAN
Research Articles on EEF1AKNMT
Similar Products
Product Notes
The EEF1AKNMT mettl13 (Catalog #AAA3206072) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EEF1AKNMT Antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EEF1AKNMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EEF1AKNMT mettl13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NEILFCQLHP EQKLATPELL ETAQALERTL RKPGRGWDDT YVLSDMLKTV. It is sometimes possible for the material contained within the vial of "EEF1AKNMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
