Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PROC Antibody Titration: 2.5ug/mlPositive Control: Transfected 293T)

Rabbit PROC Polyclonal Antibody | anti-PROC antibody

PROC antibody - N-terminal region

Gene Names
PROC; PC; APC; PROC1; THPH3; THPH4
Reactivity
Cow, Horse, Human, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
PROC; Polyclonal Antibody; PROC antibody - N-terminal region; anti-PROC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL
Sequence Length
461
Applicable Applications for anti-PROC antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 79%; Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PROC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PROC Antibody Titration: 2.5ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-PROC Antibody Titration: 2.5ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-PROC antibody
This is a rabbit polyclonal antibody against PROC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
vitamin K-dependent protein C preproprotein
NCBI Official Synonym Full Names
protein C, inactivator of coagulation factors Va and VIIIa
NCBI Official Symbol
PROC
NCBI Official Synonym Symbols
PC; APC; PROC1; THPH3; THPH4
NCBI Protein Information
vitamin K-dependent protein C
UniProt Protein Name
Vitamin K-dependent protein C
Protein Family
UniProt Gene Name
PROC
UniProt Entry Name
PROC_HUMAN

NCBI Description

This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 2009]

Uniprot Description

PROC: Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids. Defects in PROC are the cause of thrombophilia due to protein C deficiency, autosomal dominant (THPH3). A hemostatic disorder characterized by impaired regulation of blood coagulation and a tendency to recurrent venous thrombosis. However, many adults with heterozygous disease may be asymptomatic. Individuals with decreased amounts of protein C are classically referred to as having type I protein C deficiency and those with normal amounts of a functionally defective protein as having type II deficiency. Defects in PROC are the cause of thrombophilia due to protein C deficiency, autosomal recessive (THPH4). A hemostatic disorder characterized by impaired regulation of blood coagulation and a tendency to recurrent venous thrombosis. It results in a thrombotic condition that can manifest as a severe neonatal disorder or as a milder disorder with late-onset thrombophilia. The severe form leads to neonatal death through massive neonatal venous thrombosis. Often associated with ecchymotic skin lesions which can turn necrotic called purpura fulminans, this disorder is very rare. Belongs to the peptidase S1 family.

Protein type: Protease; Apoptosis; EC 3.4.21.69

Chromosomal Location of Human Ortholog: 2q13-q14

Cellular Component: endoplasmic reticulum lumen; Golgi lumen; extracellular region

Molecular Function: protein binding; serine-type endopeptidase activity; calcium ion binding

Biological Process: cellular protein metabolic process; negative regulation of blood coagulation; blood coagulation; proteolysis; post-translational protein modification; peptidyl-glutamic acid carboxylation; leukocyte migration; negative regulation of apoptosis

Disease: Thrombophilia Due To Protein C Deficiency, Autosomal Recessive; Thrombophilia Due To Protein C Deficiency, Autosomal Dominant

Research Articles on PROC

Similar Products

Product Notes

The PROC proc (Catalog #AAA3205988) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PROC antibody - N-terminal region reacts with Cow, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PROC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PROC proc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MWQLTSLLLF VATWGISGTP APLDSVFSSS ERAHQVLRIR KRANSFLEEL. It is sometimes possible for the material contained within the vial of "PROC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.