Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DDC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Rabbit DDC Polyclonal Antibody | anti-DDC antibody

DDC antibody - middle region

Gene Names
DDC; AADC
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DDC; Polyclonal Antibody; DDC antibody - middle region; anti-DDC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL
Sequence Length
480
Applicable Applications for anti-DDC antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DDC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DDC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-DDC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)
Related Product Information for anti-DDC antibody
This is a rabbit polyclonal antibody against DDC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Product Categories/Family for anti-DDC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
aromatic-L-amino-acid decarboxylase isoform 1
NCBI Official Synonym Full Names
dopa decarboxylase
NCBI Official Symbol
DDC
NCBI Official Synonym Symbols
AADC
NCBI Protein Information
aromatic-L-amino-acid decarboxylase
UniProt Protein Name
Aromatic-L-amino-acid decarboxylase
UniProt Gene Name
DDC
UniProt Synonym Gene Names
AADC; AADC; DDC
UniProt Entry Name
DDC_HUMAN

NCBI Description

The encoded protein catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Defects in this gene are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD). AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

DDC: Catalyzes the decarboxylation of L-3,4- dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Homodimer. Belongs to the group II decarboxylase family.

Protein type: Amino Acid Metabolism - tryptophan; EC 4.1.1.28; Amino Acid Metabolism - histidine; Amino Acid Metabolism - tyrosine; Nuclear receptor co-regulator; Amino Acid Metabolism - phenylalanine; Lyase

Chromosomal Location of Human Ortholog: 7p12.2

Cellular Component: synaptic vesicle; cell soma; axon; cytosol

Molecular Function: aromatic-L-amino-acid decarboxylase activity; protein domain specific binding; amino acid binding; protein binding; enzyme binding; pyridoxal phosphate binding

Biological Process: circadian rhythm; amino acid metabolic process; catecholamine biosynthetic process; indolalkylamine biosynthetic process; multicellular organismal aging; isoquinoline alkaloid metabolic process; dopamine biosynthetic process; serotonin biosynthetic process; phytoalexin metabolic process; synaptic vesicle amine transport; response to pyrethroid

Disease: Aromatic L-amino Acid Decarboxylase Deficiency

Research Articles on DDC

Similar Products

Product Notes

The DDC ddc (Catalog #AAA3205836) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDC antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DDC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDC ddc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLKMWFVFRM YGVKGLQAYI RKHVQLSHEF ESLVRQDPRF EICVEVILGL. It is sometimes possible for the material contained within the vial of "DDC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.