Western Blot (WB)
(WB Suggested Anti-SDS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Rabbit SDS Polyclonal Antibody | anti-SDS antibody
SDS antibody - middle region
Gene Names
SDS; SDH
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SDS; Polyclonal Antibody; SDS antibody - middle region; anti-SDS antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI
Sequence Length
328
Applicable Applications for anti-SDS antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SDS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SDS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SDS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Related Product Information for anti-SDS antibody
This is a rabbit polyclonal antibody against SDS. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine t
Target Description: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine t
Product Categories/Family for anti-SDS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
L-serine dehydratase/L-threonine deaminase
NCBI Official Synonym Full Names
serine dehydratase
NCBI Official Symbol
SDS
NCBI Official Synonym Symbols
SDH
NCBI Protein Information
L-serine dehydratase/L-threonine deaminase
UniProt Protein Name
L-serine dehydratase/L-threonine deaminase
Protein Family
UniProt Gene Name
SDS
UniProt Synonym Gene Names
SDH; SDH; TDH
UniProt Entry Name
SDHL_HUMAN
NCBI Description
This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine to NH4+ and 2-ketobutyrate. The encoded protein is found predominantly in the liver. [provided by RefSeq, Jul 2008]
Uniprot Description
Catalytic activity: L-serine = pyruvate + NH3. Ref.4L-threonine = 2-oxobutanoate + NH3. Ref.4
Cofactor: Pyridoxal phosphate.
Pathway: Carbohydrate biosynthesis; gluconeogenesis.
Subunit structure: Homodimer.
Subcellular location: Cytoplasm.
Sequence similarities: Belongs to the serine/threonine dehydratase family.
Biophysicochemical propertiesKinetic parameters:KM=23 mM for serine Ref.4KM=31 mM for threonine
Research Articles on SDS
Similar Products
Product Notes
The SDS sds (Catalog #AAA3205929) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDS antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SDS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SDS sds for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KITSVAKALG VKTVGAQALK LFQEHPIFSE VISDQEAVAA IEKFVDDEKI. It is sometimes possible for the material contained within the vial of "SDS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
