Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DUSP21 polyclonal antibody. Western Blot analysis of DUSP21 expression in human colon.)

Mouse anti-Human DUSP21 Polyclonal Antibody | anti-DUSP21 antibody

DUSP21 ((Dual Specificity Protein Phosphatase 21, Low Molecular Weight Dual Specificity Phosphatase 21, LMW-DSP21, LMWDSP21, MGC149878)

Gene Names
DUSP21; LMWDSP21
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DUSP21; Polyclonal Antibody; DUSP21 ((Dual Specificity Protein Phosphatase 21; Low Molecular Weight Dual Specificity Phosphatase 21; LMW-DSP21; LMWDSP21; MGC149878); Anti -DUSP21 ((Dual Specificity Protein Phosphatase 21; anti-DUSP21 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DUSP21.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRTMISM
Applicable Applications for anti-DUSP21 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human DUSP21, aa1-190 (NP_071359.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DUSP21 polyclonal antibody. Western Blot analysis of DUSP21 expression in human colon.)

Western Blot (WB) (DUSP21 polyclonal antibody. Western Blot analysis of DUSP21 expression in human colon.)

Western Blot (WB)

(Western Blot analysis of DUSP21 expression in transfected 293T cell line by DUSP21 polyclonal antibody. Lane 1: DUSP21 transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DUSP21 expression in transfected 293T cell line by DUSP21 polyclonal antibody. Lane 1: DUSP21 transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DUSP21 antibody
DUSP21 is member of the dual-specificity phosphatase (DSP) family, which catalyzes dephosphorylation of phosphotyrosine and phosphothreonine residues.
Product Categories/Family for anti-DUSP21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,529 Da
NCBI Official Full Name
dual specificity protein phosphatase 21
NCBI Official Synonym Full Names
dual specificity phosphatase 21
NCBI Official Symbol
DUSP21
NCBI Official Synonym Symbols
LMWDSP21
NCBI Protein Information
dual specificity protein phosphatase 21; LMW-DSP21; BJ-HCC-26 tumor antigen; low molecular weight dual specificity phosphatase 21
UniProt Protein Name
Dual specificity protein phosphatase 21
UniProt Gene Name
DUSP21
UniProt Synonym Gene Names
LMWDSP21; LMW-DSP21
UniProt Entry Name
DUS21_HUMAN

NCBI Description

This gene encodes a member of the dual specificity phosphatase family, specifically the low molecular weight dual specificity phosphatase family. The encoded protein localizes to both the cytoplasm and the nucleus and functions to remove phosphate groups from phosphotyrosine and phosphothreonine residues.[provided by RefSeq, Mar 2009]

Uniprot Description

DUSP21: Can dephosphorylate single and diphosphorylated synthetic MAPK peptides, with preference for the phosphotyrosine and diphosphorylated forms over phosphothreonine. Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.

Protein type: EC 3.1.3.48; Motility/polarity/chemotaxis; EC 3.1.3.16; Mitochondrial; Protein phosphatase, dual-specificity

Chromosomal Location of Human Ortholog: Xp11.4-p11.23

Cellular Component: mitochondrial matrix; cytoplasm; nucleus

Molecular Function: protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; MAP kinase tyrosine/serine/threonine phosphatase activity

Biological Process: inactivation of MAPK activity

Similar Products

Product Notes

The DUSP21 dusp21 (Catalog #AAA642479) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DUSP21 ((Dual Specificity Protein Phosphatase 21, Low Molecular Weight Dual Specificity Phosphatase 21, LMW-DSP21, LMWDSP21, MGC149878) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DUSP21 dusp21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTASASSFSS SQGVQQPSIY SFSQITRSLF LSNGVAANDK LLLSSNRITA IVNASVEVVN VFFEGIQYIK VPVTDARDSR LYDFFDPIAD LIHTIDMRQG RTLLHCMAGV SRSASLCLAY LMKYHSMSLL DAHTWTKSRR PIIRPNNGFW EQLINYEFKL FNNNTVRMIN SPVGNIPDIY EKDLRTMISM. It is sometimes possible for the material contained within the vial of "DUSP21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.