Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DUSP22 expression in transfected 293T cell line by DUSP22 polyclonal antibody. Lane 1: DUSP22 transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human DUSP22 Polyclonal Antibody | anti-DUSP22 antibody

DUSP22 (Dual Specificity Protein Phosphatase 22, JKAP, JNK-stimulatory Phosphatase-1, JSP1, JSP-1, Low Molecular Weight Dual Specificity Phosphatase 2, LMWDSP2, LMW-DSP2, Mitogen-activated Protein Kinase Phosphatase x, MAP Kinase Phosphatase x, MKPX, MKP-

Gene Names
DUSP22; VHX; JKAP; JSP1; MKPX; LMWDSP2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DUSP22; Polyclonal Antibody; DUSP22 (Dual Specificity Protein Phosphatase 22; JKAP; JNK-stimulatory Phosphatase-1; JSP1; JSP-1; Low Molecular Weight Dual Specificity Phosphatase 2; LMWDSP2; LMW-DSP2; Mitogen-activated Protein Kinase Phosphatase x; MAP Kinase Phosphatase x; MKPX; MKP-; anti-DUSP22 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DUSP22.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DUSP22 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DUSP22, aa1-184 (NP_064570.1).
Immunogen Sequence
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DUSP22 expression in transfected 293T cell line by DUSP22 polyclonal antibody. Lane 1: DUSP22 transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DUSP22 expression in transfected 293T cell line by DUSP22 polyclonal antibody. Lane 1: DUSP22 transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DUSP22 antibody
DUSP22 is member of the dual-specificity phosphatase (DSP) family, which catalyzes dephosphorylation of phosphotyrosine and phosphothreonine residues.
Product Categories/Family for anti-DUSP22 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,910 Da
NCBI Official Full Name
dual specificity protein phosphatase 22
NCBI Official Synonym Full Names
dual specificity phosphatase 22
NCBI Official Symbol
DUSP22
NCBI Official Synonym Symbols
VHX; JKAP; JSP1; MKPX; LMWDSP2
NCBI Protein Information
dual specificity protein phosphatase 22; JSP-1; MKP-x; LMW-DSP2; MAP kinase phosphatase x; JNK-stimulating phosphatase 1; JNK-stimulatory phosphatase-1; mitogen-activated protein kinase phosphatase x; low molecular weight dual specificity phosphatase 2; h
UniProt Protein Name
Dual specificity protein phosphatase 22
UniProt Gene Name
DUSP22
UniProt Synonym Gene Names
JSP1; LMWDSP2; MKPX; JSP-1; LMW-DSP2; MAP kinase phosphatase x; MKP-x
UniProt Entry Name
DUS22_HUMAN

Uniprot Description

DUSP22: Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N- terminal kinase (SAPK/JNK). Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; EC 3.1.3.16; Motility/polarity/chemotaxis; EC 3.1.3.48; Protein phosphatase, dual-specificity

Chromosomal Location of Human Ortholog: 6p25.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity

Biological Process: cell proliferation; apoptosis; transforming growth factor beta receptor signaling pathway; multicellular organismal development; positive regulation of JNK cascade; negative regulation of transcription from RNA polymerase II promoter; protein amino acid dephosphorylation; inactivation of MAPK activity; regulation of cell proliferation

Research Articles on DUSP22

Similar Products

Product Notes

The DUSP22 dusp22 (Catalog #AAA6376700) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DUSP22 (Dual Specificity Protein Phosphatase 22, JKAP, JNK-stimulatory Phosphatase-1, JSP1, JSP-1, Low Molecular Weight Dual Specificity Phosphatase 2, LMWDSP2, LMW-DSP2, Mitogen-activated Protein Kinase Phosphatase x, MAP Kinase Phosphatase x, MKPX, MKP- reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DUSP22 dusp22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DUSP22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.