Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Mouse LHX6 Monoclonal Antibody
LHX6 (LIM/Homeobox Protein Lhx6, LIM Homeobox Protein 6, LIM/Homeobox Protein Lhx6.1, LHX6.1)
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
LHX6; Monoclonal Antibody; LHX6 (LIM/Homeobox Protein Lhx6; LIM Homeobox Protein 6; LIM/Homeobox Protein Lhx6.1; LHX6.1); Anti -LHX6 (LIM/Homeobox Protein Lhx6; anti-LHX6 antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D9
Specificity
Recognizes human LHX6. Species Crossreactivity: mouse and rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY*
Applicable Applications for anti-LHX6 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa274-364 from human LHX6 (NP_055183) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Western Blot (WB)
(LHX6 monoclonal antibody. Western Blot analysis of LHX6 expression in PC-12.)
Western Blot (WB)
(LHX6 monoclonal antibody. Western Blot analysis of LHX6 expression in PC-12.)
Western Blot (WB)
(LHX6 monoclonal antibody Western Blot analysis of LHX6 expression in Raw 264.7.)
Western Blot (WB)
(LHX6 monoclonal antibody Western Blot analysis of LHX6 expression in Raw 264.7.)
Related Product Information for anti-LHX6 antibody
Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex.
Product Categories/Family for anti-LHX6 antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The LHX6 (Catalog #AAA643529) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LHX6 (LIM/Homeobox Protein Lhx6, LIM Homeobox Protein 6, LIM/Homeobox Protein Lhx6.1, LHX6.1) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LHX6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the LHX6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HKKHTPQHPV PPSGAPPSRL PSALSDDIHY TPFSSPERAR MVTLHGYIES QVQCGQVHCR LPYTAPPVHL KADMDGPLSN RGEKVILFQY *. It is sometimes possible for the material contained within the vial of "LHX6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
