Mouse anti-Human IFITM2 Monoclonal Antibody | anti-IFITM2 antibody

IFITM2 (Interferon-induced Transmembrane Protein 2, Dispanin Subfamily A Member 2c, DSPA2c, Interferon-inducible Protein 1-8D) (PE)

Cat. Num. AAA6158325

• Gene Names: IFITM2; 1-8D; DSPA2c
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IFITM2; Monoclonal Antibody; IFITM2 (Interferon-induced Transmembrane Protein 2; Dispanin Subfamily A Member 2c; DSPA2c; Interferon-inducible Protein 1-8D) (PE); anti-IFITM2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F2
• Specificity: Recognizes human IFITM2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-IFITM2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-59 from IFITM2 (NP_006426) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGAPHNPAPPTSTVIHIRSETSVPDHVVW
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.6kD).)

Western Blot (WB)

(IFITM2 monoclonal antibody Western Blot analysis of IFITM2 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of IFITM2 expression in transfected 293T cell line by IFITM2 monoclonal antibody. Lane 1: IFITM2 transfected lysate (Predicted MW: 14.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged IFITM2 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-IFITM2 antibody

Antibodies; Transmembrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 151101191
• NCBI GeneID: 10581
• NCBI Accession #: NP_006426
• NCBI GenBank Nucleotide #: NM_006435
• UniProt Accession #: Q01629
• Molecular Weight: 14kDa
• NCBI Official Full Name: interferon-induced transmembrane protein 2
• NCBI Official Synonym Full Names: interferon induced transmembrane protein 2
• NCBI Official Symbol: IFITM2
• NCBI Official Synonym Symbols: 1-8D; DSPA2c
• NCBI Protein Information: interferon-induced transmembrane protein 2
• UniProt Protein Name: Interferon-induced transmembrane protein 2
• Protein Family: Interferon-induced transmembrane protein
• UniProt Gene Name: IFITM2
• UniProt Synonym Gene Names: DSPA2c
• UniProt Entry Name: IFM2_HUMAN

Uniprot Description

IFITM2: IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and vesicular stomatitis virus (VSV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, SARS-CoV S protein-mediated viral entry and VSV G protein- mediated viral entry. Induces cell cycle arrest and mediates apoptosis by caspase activation and in p53-independent manner. Belongs to the CD225/Dispanin family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: integral to membrane; plasma membrane

Biological Process: cytokine and chemokine mediated signaling pathway; defense response to virus; immune response; negative regulation of viral genome replication; negative regulation of virion penetration into host cell; response to virus