Western Blot (WB)
(CK2 alpha 1 antibody (MBS5302912) used at 1 ug/ml to detect target protein.)
Rabbit CK2 alpha 1 Polyclonal Antibody | anti-CK2 alpha 1 antibody
CK2 alpha 1 antibody
Reactivity
Human, Mouse, Rat, C.elegans, Drosophila
Applications
Western Blot
Purity
Affinity purified
Synonyms
CK2 alpha 1; Polyclonal Antibody; CK2 alpha 1 antibody; Polyclonal CK2 alpha 1; Anti-CK2 alpha 1; CK-2; Casein Kinase 2 Alpha 1 Polypeptide; CK1G3; CK 2; CSNK2A1; CKII alpha; CK2A1; CK2; CKII; anti-CK2 alpha 1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, C.elegans, Drosophila
Clonality
Polyclonal
Specificity
CK2 alpha 1 antibody was raised against the middle region of CSNK2A1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSNK2A1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-CK2 alpha 1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. CSNK2A1 represents the alpha subunit.
Cross-Reactivity
Human,Mouse,Rat,C.elegans,Drosophila
Immunogen
CK2 alpha 1 antibody was raised using the middle region of CSNK2A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(CK2 alpha 1 antibody (MBS5302912) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(CK2 alpha 1 antibody (MBS5302912) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CK2 alpha 1 antibody
Rabbit polyclonal CK2 alpha 1 antibody raised against the middle region of CSNK2A1
Product Categories/Family for anti-CK2 alpha 1 antibody
Similar Products
Product Notes
The CK2 alpha 1 (Catalog #AAA5302912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CK2 alpha 1 antibody reacts with Human, Mouse, Rat, C.elegans, Drosophila and may cross-react with other species as described in the data sheet. AAA Biotech's CK2 alpha 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CK2 alpha 1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CK2 alpha 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
