Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Mucolipin 3 antibody (MBS839181) used at 1 ug/ml to detect target protein.)

Rabbit Mucolipin 3 Polyclonal Antibody | anti-MCOLN3 antibody

Mucolipin 3 antibody

Gene Names
MCOLN3; TRPML3; TRP-ML3
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Mucolipin 3; Polyclonal Antibody; Mucolipin 3 antibody; Polyclonal Mucolipin 3; Anti-Mucolipin 3; MCOLN3; Mucolipin -3; MGC71509; FLJ11006; TRPML3; TRP-ML3; FLJ36629; anti-MCOLN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Mucolipin 3 antibody was raised against the middle region of MCOLN3
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCOLN3 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
497
Applicable Applications for anti-MCOLN3 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Mucolipins constitute a family of cation channel proteins with homologs in mouse, Drosophila, and C. elegans. Mutations in the human MCOLN1 gene cause mucolipodosis IV.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Mucolipin 3 antibody was raised using the middle region of MCOLN3 corresponding to a region with amino acids TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Mucolipin 3 antibody (MBS839181) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Mucolipin 3 antibody (MBS839181) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-MCOLN3 antibody
Rabbit polyclonal Mucolipin 3 antibody raised against the middle region of MCOLN3
Product Categories/Family for anti-MCOLN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
64 kDa (MW of target protein)
NCBI Official Full Name
mucolipin-3 isoform 2
NCBI Official Synonym Full Names
mucolipin 3
NCBI Official Symbol
MCOLN3
NCBI Official Synonym Symbols
TRPML3; TRP-ML3
NCBI Protein Information
mucolipin-3
UniProt Protein Name
Mucolipin-3
Protein Family
UniProt Gene Name
MCOLN3
UniProt Entry Name
MCLN3_HUMAN

NCBI Description

This gene encodes one of members of the mucolipin cation channel proteins. Mutation studies of the highly similar protein in mice have shown that the protein is found in cochlea hair cells, and mutant mice show early-onset hearing loss and balance problems. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

MCOLN3: one of members of the mucolipin cation channel proteins. Mutation studies of the highly similar protein in mice have shown that the protein is found in cochlea hair cells, and mutant mice show early-onset hearing loss and balance problems. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, cation

Chromosomal Location of Human Ortholog: 1p22.3

Cellular Component: cytoplasm; plasma membrane; integral to membrane

Biological Process: auditory receptor cell differentiation; locomotory behavior; transmembrane transport

Research Articles on MCOLN3

Similar Products

Product Notes

The MCOLN3 mcoln3 (Catalog #AAA839181) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Mucolipin 3 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Mucolipin 3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MCOLN3 mcoln3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Mucolipin 3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.