Western Blot (WB)
(SLC38A4 antibody (MBS5301251) used at 2.5 ug/ml to detect target protein.)
Rabbit SLC38A4 Polyclonal Antibody | anti-SLC38A4 antibody
SLC38A4 antibody
Reactivity
Human, Mouse, Rat, Dog, C.elegans, Drosophila, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
SLC38A4; Polyclonal Antibody; SLC38A4 antibody; Polyclonal SLC38A4; Anti-SLC38A4; Solute Carrier Family 38 Member 4; SLCA4 38; SLCA4-38; FLJ10191; NAT3; ATA3; PAAT; MGC126876; anti-SLC38A4 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog, C.elegans, Drosophila, Zebrafish
Clonality
Polyclonal
Specificity
SLC38A4 antibody was raised against the middle region of SLC38A4
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC38A4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-SLC38A4 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 2.5 ug/ml
IHC: 4-8 ug/ml
IHC: 4-8 ug/ml
Biological Significance
SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.
Cross-Reactivity
Human, Mouse, Rat, Dog, C.elegans, Drosophila, ZebraFish
Immunogen
SLC38A4 antibody was raised using the middle region of SLC38A4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(SLC38A4 antibody (MBS5301251) used at 2.5 ug/ml to detect target protein.)
Western Blot (WB)
(SLC38A4 antibody (MBS5301251) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-SLC38A4 antibody
Rabbit polyclonal SLC38A4 antibody raised against the middle region of SLC38A4
Product Categories/Family for anti-SLC38A4 antibody
Similar Products
Product Notes
The SLC38A4 (Catalog #AAA5301251) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC38A4 antibody reacts with Human, Mouse, Rat, Dog, C.elegans, Drosophila, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC38A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 2.5 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the SLC38A4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC38A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
