Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Ankyrin 1 antibody (MBS5302770) used at 1 ug/ml to detect target protein.)

Rabbit Ankyrin 1 Polyclonal Antibody | anti-ANK1 antibody

Ankyrin 1 antibody

Gene Names
ANK1; ANK; SPH1; SPH2
Applications
Western Blot
Purity
Affinity purified
Synonyms
Ankyrin 1; Polyclonal Antibody; Ankyrin 1 antibody; Polyclonal Ankyrin 1; Anti-Ankyrin 1; Ankyrin 1 Erythrocytic; SPH2; SPH1; ANK1; anti-ANK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Ankyrin 1 antibody was raised against the middle region of ANK1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANK1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1881
Applicable Applications for anti-ANK1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation and proliferation.
Cross-Reactivity
Human
Immunogen
Ankyrin 1 antibody was raised using the middle region of ANK1 corresponding to a region with amino acids PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Ankyrin 1 antibody (MBS5302770) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Ankyrin 1 antibody (MBS5302770) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ANK1 antibody
Rabbit polyclonal Ankyrin 1 antibody raised against the middle region of ANK1
Product Categories/Family for anti-ANK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
286
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
189 kDa (MW of target protein)
NCBI Official Full Name
ankyrin-1 isoform 1
NCBI Official Synonym Full Names
ankyrin 1, erythrocytic
NCBI Official Symbol
ANK1
NCBI Official Synonym Symbols
ANK; SPH1; SPH2
NCBI Protein Information
ankyrin-1
UniProt Protein Name
Ankyrin-1
Protein Family
UniProt Gene Name
ANK1
UniProt Synonym Gene Names
ANK; ANK-1
UniProt Entry Name
ANK1_HUMAN

NCBI Description

Ankyrins are a family of proteins that link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact and the maintenance of specialized membrane domains. Multiple isoforms of ankyrin with different affinities for various target proteins are expressed in a tissue-specific, developmentally regulated manner. Most ankyrins are typically composed of three structural domains: an amino-terminal domain containing multiple ankyrin repeats; a central region with a highly conserved spectrin binding domain; and a carboxy-terminal regulatory domain which is the least conserved and subject to variation. Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has also been found in brain and muscles. Mutations in erythrocytic ankyrin 1 have been associated in approximately half of all patients with hereditary spherocytosis. Complex patterns of alternative splicing in the regulatory domain, giving rise to different isoforms of ankyrin 1 have been described. Truncated muscle-specific isoforms of ankyrin 1 resulting from usage of an alternate promoter have also been identified. [provided by RefSeq, Dec 2008]

Uniprot Description

ANK1: Attaches integral membrane proteins to cytoskeletal elements; binds to the erythrocyte membrane protein band 4.2, to Na-K ATPase, to the lymphocyte membrane protein GP85, and to the cytoskeletal proteins fodrin, tubulin, vimentin and desmin. Erythrocyte ankyrins also link spectrin (beta chain) to the cytoplasmic domain of the erythrocytes anion exchange protein; they retain most or all of these binding functions. Defects in ANK1 are a cause of spherocytosis type 1 (SPH1); also called hereditary spherocytosis type 1 (HS1). Spherocytosis is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal. Inheritance can be autosomal dominant or recessive. 21 isoforms of the human protein are produced by alternative promoter.

Protein type: Adaptor/scaffold; Endoplasmic reticulum; Cell development/differentiation; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p11.1

Cellular Component: cortical cytoskeleton; postsynaptic membrane; cytoskeleton; sarcoplasmic reticulum; basolateral plasma membrane; plasma membrane; M band; axolemma; cytosol; nucleus; Z disc; sarcolemma

Molecular Function: protein binding; enzyme binding; spectrin binding; structural constituent of cytoskeleton; cytoskeletal adaptor activity; structural molecule activity; ATPase binding

Biological Process: axon guidance; ER to Golgi vesicle-mediated transport; iron ion homeostasis; erythrocyte development; exocytosis; monovalent inorganic cation transport; cytoskeleton organization and biogenesis; signal transduction; porphyrin biosynthetic process; maintenance of epithelial cell polarity

Disease: Spherocytosis, Type 1

Research Articles on ANK1

Similar Products

Product Notes

The ANK1 ank1 (Catalog #AAA5302770) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Ankyrin 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ANK1 ank1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ankyrin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.