Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CAPN6Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CAPN6 Polyclonal Antibody | anti-CAPN6 antibody

CAPN6 Antibody - middle region

Gene Names
CAPN6; CANPX; CAPNX; CalpM; DJ914P14.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CAPN6; Polyclonal Antibody; CAPN6 Antibody - middle region; anti-CAPN6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVF
Sequence Length
641
Applicable Applications for anti-CAPN6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAPN6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CAPN6Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CAPN6Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CAPN6 antibody
Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to the calmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to be proteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promoting angiogenesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
827
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75 kDa
NCBI Official Full Name
calpain-6
NCBI Official Synonym Full Names
calpain 6
NCBI Official Symbol
CAPN6
NCBI Official Synonym Symbols
CANPX; CAPNX; CalpM; DJ914P14.1
NCBI Protein Information
calpain-6
UniProt Protein Name
Calpain-6
Protein Family
UniProt Gene Name
CAPN6
UniProt Synonym Gene Names
CALPM; CANPX; CalpM
UniProt Entry Name
CAN6_HUMAN

NCBI Description

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to the calmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to be proteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promoting angiogenesis. [provided by RefSeq, Nov 2009]

Uniprot Description

CAPN6: Microtubule-stabilizing protein that may be involved in the regulation of microtubule dynamics and cytoskeletal organization. May act as a regulator of RAC1 activity through interaction with ARHGEF2 to control lamellipodial formation and cell mobility. Does not seem to have protease activity as it has lost the active site residues. Belongs to the peptidase C2 family.

Chromosomal Location of Human Ortholog: Xq23

Cellular Component: spindle microtubule; perinuclear region of cytoplasm

Molecular Function: microtubule binding; calcium-dependent cysteine-type endopeptidase activity

Biological Process: proteolysis; microtubule bundle formation; regulation of cytoskeleton organization and biogenesis

Research Articles on CAPN6

Similar Products

Product Notes

The CAPN6 capn6 (Catalog #AAA3221287) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPN6 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAPN6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPN6 capn6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TIPNHKEQEW DPQKTEKYAG IFHFRFWHFG EWTEVVIDDL LPTINGDLVF. It is sometimes possible for the material contained within the vial of "CAPN6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.