Western Blot (WB)
(Host: RabbitTarget Name: CAP1Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse CAP1 Polyclonal Antibody | anti-CAP1 antibody
CAP1 Antibody - middle region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CAP1; Polyclonal Antibody; CAP1 Antibody - middle region; anti-CAP1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATK
Sequence Length
474
Applicable Applications for anti-CAP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CAP1Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CAP1Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CAP1 antibody
The product of this gene plays a role in regulating actin dynamics by binding actin monomers and promoting the turnover of actin filaments. Reduced expression of this gene causes a reduction in actin filament turnover rates, causing multiple defects, including an increase in cell size, stress-fiber alterations, and defects in endocytosis and cell motility. A pseudogene of this gene is found on chromosome 14. Alternative splicing results in multiple transcript variants, but does not affect the protein.
Product Categories/Family for anti-CAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
adenylyl cyclase-associated protein 1
NCBI Official Synonym Full Names
CAP, adenylate cyclase-associated protein 1 (yeast)
NCBI Official Symbol
Cap1
NCBI Protein Information
adenylyl cyclase-associated protein 1
UniProt Protein Name
Adenylyl cyclase-associated protein 1
Protein Family
UniProt Gene Name
Cap1
UniProt Synonym Gene Names
Cap; CAP 1
UniProt Entry Name
CAP1_MOUSE
NCBI Description
The product of this gene plays a role in regulating actin dynamics by binding actin monomers and promoting the turnover of actin filaments. Reduced expression of this gene causes a reduction in actin filament turnover rates, causing multiple defects, including an increase in cell size, stress-fiber alterations, and defects in endocytosis and cell motility. A pseudogene of this gene is found on chromosome 14. Alternative splicing results in multiple transcript variants, but does not affect the protein. [provided by RefSeq, Jul 2014]
Research Articles on CAP1
Similar Products
Product Notes
The CAP1 cap1 (Catalog #AAA3223670) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAP1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAP1 cap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITHALKHVSD DMKTHKNPAL KAQSGPVRSG PKPFSAPKPQ TSPSPKPATK. It is sometimes possible for the material contained within the vial of "CAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
