Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TLL1Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TLL1 Polyclonal Antibody | anti-TLL1 antibody

TLL1 Antibody - middle region

Gene Names
TLL1; TLL; ASD6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TLL1; Polyclonal Antibody; TLL1 Antibody - middle region; anti-TLL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLT
Sequence Length
1013
Applicable Applications for anti-TLL1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TLL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TLL1Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TLL1Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TLL1 antibody
This gene encodes an astacin-like, zinc-dependent, metalloprotease that belongs to the peptidase M12A family. This protease processes procollagen C-propeptides, such as chordin, pro-biglycan and pro-lysyl oxidase. Studies in mice suggest that this gene plays multiple roles in the development of mammalian heart, and is essential for the formation of the interventricular septum. Allelic variants of this gene are associated with atrial septal defect type 6. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TLL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115 kDa
NCBI Official Full Name
tolloid-like protein 1 isoform 1
NCBI Official Synonym Full Names
tolloid like 1
NCBI Official Symbol
TLL1
NCBI Official Synonym Symbols
TLL; ASD6
NCBI Protein Information
tolloid-like protein 1
UniProt Protein Name
Tolloid-like protein 1
Protein Family
UniProt Gene Name
TLL1
UniProt Synonym Gene Names
TLL
UniProt Entry Name
TLL1_HUMAN

NCBI Description

This gene encodes an astacin-like, zinc-dependent, metalloprotease that belongs to the peptidase M12A family. This protease processes procollagen C-propeptides, such as chordin, pro-biglycan and pro-lysyl oxidase. Studies in mice suggest that this gene plays multiple roles in the development of mammalian heart, and is essential for the formation of the interventricular septum. Allelic variants of this gene are associated with atrial septal defect type 6. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

TLL1: Protease which processes procollagen C-propeptides, such as chordin, pro-biglycan and pro-lysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis. Defects in TLL1 are the cause of atrial septal defect type 6 (ASD6). A congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria. Belongs to the peptidase M12A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Protease; Secreted; EC 3.4.24.-

Chromosomal Location of Human Ortholog: 4q32-q33

Cellular Component: extracellular region

Molecular Function: collagen binding; zinc ion binding; metalloendopeptidase activity; calcium ion binding

Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; cell differentiation; proteolysis; skeletal development

Disease: Atrial Septal Defect 6

Research Articles on TLL1

Similar Products

Product Notes

The TLL1 tll1 (Catalog #AAA3222580) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TLL1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TLL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TLL1 tll1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FAAVYEAICG GEIRKNEGQI QSPNYPDDYR PMKECVWKIT VSESYHVGLT. It is sometimes possible for the material contained within the vial of "TLL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.