Western Blot (WB)
(Host: RabbitTarget Name: CRY1Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse CRY1 Polyclonal Antibody | anti-CRY1 antibody
CRY1 Antibody - middle region
Gene Names
Cry1; Phll1; AU020726; AU021000
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CRY1; Polyclonal Antibody; CRY1 Antibody - middle region; anti-CRY1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYL
Sequence Length
606
Applicable Applications for anti-CRY1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CRY1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CRY1Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CRY1Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CRY1 antibody
This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by Clock/Arntl heterodimers but then represses this upregulation in a feedback loop using Per/Cry heterodimers to interact with Clock/Arntl. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of this gene results in a shortened circadian cycle in complete darkness.
Product Categories/Family for anti-CRY1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66 kDa
NCBI Official Full Name
cryptochrome-1
NCBI Official Synonym Full Names
cryptochrome 1 (photolyase-like)
NCBI Official Symbol
Cry1
NCBI Official Synonym Symbols
Phll1; AU020726; AU021000
NCBI Protein Information
cryptochrome-1
UniProt Protein Name
Cryptochrome-1
Protein Family
UniProt Gene Name
Cry1
UniProt Entry Name
CRY1_MOUSE
NCBI Description
This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by Clock/Arntl heterodimers but then represses this upregulation in a feedback loop using Per/Cry heterodimers to interact with Clock/Arntl. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of this gene results in a shortened circadian cycle in complete darkness. [provided by RefSeq, Feb 2014]
Research Articles on CRY1
Similar Products
Product Notes
The CRY1 cry1 (Catalog #AAA3223609) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRY1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CRY1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRY1 cry1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLLDADWSIN AGSWMWLSCS SFFQQFFHCY CPVGFGRRTD PNGDYIRRYL. It is sometimes possible for the material contained within the vial of "CRY1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
