Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anoctamin 6 antibody (MBS5300842) used at 1 ug/ml to detect target protein.)

Rabbit Anoctamin 6 Polyclonal Antibody | anti-ANO6 antibody

Anoctamin 6 antibody

Gene Names
ANO6; SCTS; BDPLT7; TMEM16F
Applications
Western Blot
Purity
Affinity purified
Synonyms
Anoctamin 6; Polyclonal Antibody; Anoctamin 6 antibody; Polyclonal Anoctamin 6; Anti-Anoctamin 6; Anoctamin -6; ANO6; MGC104751; anti-ANO6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Anoctamin 6 antibody was raised against the middle region of ANO6
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANO6 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
910
Applicable Applications for anti-ANO6 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM16F may act as a calcium-activated chloride channel.
Cross-Reactivity
Human
Immunogen
Anoctamin 6 antibody was raised using the middle region of ANO6 corresponding to a region with amino acids KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Anoctamin 6 antibody (MBS5300842) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Anoctamin 6 antibody (MBS5300842) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ANO6 antibody
Rabbit polyclonal Anoctamin 6 antibody raised against the middle region of ANO6
Product Categories/Family for anti-ANO6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
106 kDa (MW of target protein)
NCBI Official Full Name
Anoctamin 6
NCBI Official Synonym Full Names
anoctamin 6
NCBI Official Symbol
ANO6
NCBI Official Synonym Symbols
SCTS; BDPLT7; TMEM16F
NCBI Protein Information
anoctamin-6
UniProt Protein Name
Anoctamin-6
Protein Family
UniProt Gene Name
ANO6
UniProt Synonym Gene Names
TMEM16F; SCAN channel
UniProt Entry Name
ANO6_HUMAN

NCBI Description

This gene encodes a multi-pass transmembrane protein that belongs to the anoctamin family. This protein is an essential component for the calcium-dependent exposure of phosphatidylserine on the cell surface. The scrambling of phospholipid occurs in various biological systems, such as when blood platelets are activated, they expose phosphatidylserine to trigger the clotting system. Mutations in this gene are associated with Scott syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]

Uniprot Description

ANO6: May act as a calcium-activated chloride channel. It is essential for calcium-dependent exposure of phosphatidylserine on the surface of activated platelets, a process necessary to trigger the clotting system. Defects in ANO6 are the cause of Scott syndrome (SCTS). A mild bleeding disorder due to impaired surface exposure of procoagulant phosphatidylserine (PS) on platelets and other blood cells, following activation with Ca(2+)-elevating agents. Belongs to the anoctamin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, ion channel

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: cell surface; membrane; plasma membrane; intracellular

Molecular Function: phospholipid scramblase activity; protein homodimerization activity; intracellular calcium activated chloride channel activity; voltage-gated chloride channel activity; voltage-gated ion channel activity; calcium activated cation channel activity

Biological Process: activation of blood coagulation via clotting cascade; dendritic cell chemotaxis; chloride transport; phospholipid scrambling; lipid transport; blood coagulation; transmembrane transport; cation transport

Disease: Scott Syndrome

Research Articles on ANO6

Similar Products

Product Notes

The ANO6 ano6 (Catalog #AAA5300842) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Anoctamin 6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ANO6 ano6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Anoctamin 6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.