Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Adam22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Liver)

Rabbit Adam22 Polyclonal Antibody | anti-ADAM22 antibody

Adam22 antibody - N-terminal region

Gene Names
Adam22; MDC2; AI854032; 2900022I03Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Adam22; Polyclonal Antibody; Adam22 antibody - N-terminal region; anti-ADAM22 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGIC
Sequence Length
821
Applicable Applications for anti-ADAM22 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Adam22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Liver)

Western Blot (WB) (WB Suggested Anti-Adam22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Liver)
Related Product Information for anti-ADAM22 antibody
This is a rabbit polyclonal antibody against Adam22. It was validated on Western Blot

Target Description: Adam22 is a probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Adam22 is involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation.Adam22 is a neuronal receptor for LGI1.
Product Categories/Family for anti-ADAM22 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 22 isoform b
NCBI Official Synonym Full Names
a disintegrin and metallopeptidase domain 22
NCBI Official Symbol
Adam22
NCBI Official Synonym Symbols
MDC2; AI854032; 2900022I03Rik
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 22
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 22
UniProt Gene Name
Adam22
UniProt Synonym Gene Names
ADAM 22
UniProt Entry Name
ADA22_MOUSE

NCBI Description

This gene encodes a member of a disintegrin and metalloprotease (ADAM) family of endoproteases that play important roles in various biological processes including cell signaling, adhesion and migration. The encoded preproprotein undergoes proteolytic processing to generate a mature, functional protein. The protein encoded by this gene is believed to lack metalloproteinase activity due to the lack of a critical catalytic motif. Mice lacking the encoded protein exhibit severe ataxia, hypomyelination and premature death. Alternative splicing results in multiple transcript variants encoding different isoforms, some of which may undergo similar processing. [provided by RefSeq, May 2016]

Uniprot Description

ADAM22: Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation. Neuronal receptor for LGI1. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cell adhesion; Membrane protein, integral

Cellular Component: cell projection; membrane; axon; integral to membrane

Molecular Function: protein binding; metallopeptidase activity; zinc ion binding; metalloendopeptidase activity

Biological Process: Schwann cell differentiation; adult locomotory behavior; gliogenesis; proteolysis; myelination in the peripheral nervous system

Research Articles on ADAM22

Similar Products

Product Notes

The ADAM22 adam22 (Catalog #AAA3208198) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Adam22 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Adam22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADAM22 adam22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AISENPLITL REFMKYRRDF IKEKADAVHL FSGSQFESSR SGAAYIGGIC. It is sometimes possible for the material contained within the vial of "Adam22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.