Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADAM30 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateADAM30 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit anti-Human ADAM30 Polyclonal Antibody | anti-ADAM30 antibody

ADAM30 antibody - N-terminal region

Gene Names
ADAM30; svph4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADAM30; Polyclonal Antibody; ADAM30 antibody - N-terminal region; anti-ADAM30 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH
Sequence Length
790
Applicable Applications for anti-ADAM30 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ADAM30
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADAM30 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateADAM30 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB) (WB Suggested Anti-ADAM30 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateADAM30 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-ADAM30 antibody
This is a rabbit polyclonal antibody against ADAM30. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involvi
Product Categories/Family for anti-ADAM30 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 30 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 30
NCBI Official Symbol
ADAM30
NCBI Official Synonym Symbols
svph4
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 30
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 30
UniProt Gene Name
ADAM30
UniProt Synonym Gene Names
ADAM 30
UniProt Entry Name
ADA30_HUMAN

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats. [provided by RefSeq, Jul 2008]

Research Articles on ADAM30

Similar Products

Product Notes

The ADAM30 adam30 (Catalog #AAA3209562) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADAM30 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAM30 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADAM30 adam30 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEWQMAPYEN KARLRDFPGS YKHPKYLELI LLFDQSRYRF VNNNLSQVIH. It is sometimes possible for the material contained within the vial of "ADAM30, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.