Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Adam23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)

Rabbit Adam23 Polyclonal Antibody | anti-ADAM23 antibody

Adam23 antibody - C-terminal region

Gene Names
Adam23; MDC3; AW046396
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Adam23; Polyclonal Antibody; Adam23 antibody - C-terminal region; anti-ADAM23 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NPNPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFD
Sequence Length
829
Applicable Applications for anti-ADAM23 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Adam23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)

Western Blot (WB) (WB Suggested Anti-Adam23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)
Related Product Information for anti-ADAM23 antibody
This is a rabbit polyclonal antibody against Adam23. It was validated on Western Blot

Target Description: Adam23 may play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.
Product Categories/Family for anti-ADAM23 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 23 preproprotein
NCBI Official Synonym Full Names
a disintegrin and metallopeptidase domain 23
NCBI Official Symbol
Adam23
NCBI Official Synonym Symbols
MDC3; AW046396
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 23
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 23
UniProt Gene Name
Adam23
UniProt Synonym Gene Names
Mdc3; ADAM 23; MDC-3
UniProt Entry Name
ADA23_MOUSE

NCBI Description

This gene encodes a member of the disintegrin family of membrane-anchored proteins that play a role in diverse biological processes such as brain development, fertilization, tumor development and inflammation. The encoded protein undergoes proteolytic processing to generate a mature polypeptide comprised of an inactive metalloprotease and disintegrin domains. Transgenic disruption of this gene in mice results in postnatal neurological defects including tremor and ataxia resulting in death by 2 weeks of age. [provided by RefSeq, Sep 2015]

Uniprot Description

ADAM23: May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion

Cellular Component: membrane; plasma membrane; integral to membrane; extracellular region

Molecular Function: protein binding; metallopeptidase activity; zinc ion binding; metalloendopeptidase activity

Biological Process: proteolysis; cell adhesion

Research Articles on ADAM23

Similar Products

Product Notes

The ADAM23 adam23 (Catalog #AAA3208177) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Adam23 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's Adam23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADAM23 adam23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NPNPPKDEGP KGPSATNLII GSIAGAILVA AIVLGGTGWG FKNVKKRRFD. It is sometimes possible for the material contained within the vial of "Adam23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.