Western Blot (WB)
(WB Suggested Anti-MEGF11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Rabbit MEGF11 Polyclonal Antibody | anti-MEGF11 antibody
MEGF11 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MEGF11; Polyclonal Antibody; MEGF11 antibody - middle region; anti-MEGF11 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LMMEELNPYTKISPALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQ
Sequence Length
969
Applicable Applications for anti-MEGF11 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MEGF11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MEGF11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-MEGF11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-MEGF11 antibody
This is a rabbit polyclonal antibody against MEGF11. It was validated on Western Blot
Target Description: The function of MEGF11 remains unknown.
Target Description: The function of MEGF11 remains unknown.
Product Categories/Family for anti-MEGF11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Full Name
multiple epidermal growth factor-like domains protein 11
NCBI Official Synonym Full Names
multiple EGF like domains 11
NCBI Official Symbol
MEGF11
NCBI Protein Information
multiple epidermal growth factor-like domains protein 11
UniProt Protein Name
Multiple epidermal growth factor-like domains protein 11
Protein Family
UniProt Gene Name
MEGF11
UniProt Synonym Gene Names
KIAA1781; Multiple EGF-like domains protein 11
UniProt Entry Name
MEG11_HUMAN
Uniprot Description
MEGF11: May regulate the mosaic spacing of specific neuron subtypes in the retina through homotypic retinal neuron repulsion. Mosaics provide a mechanism to distribute each cell type evenly across the retina, ensuring that all parts of the visual field have access to a full set of processing elements. Belongs to the MEGF family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 15q22.31
Cellular Component: basolateral plasma membrane; integral to membrane
Biological Process: homotypic cell-cell adhesion
Research Articles on MEGF11
Similar Products
Product Notes
The MEGF11 megf11 (Catalog #AAA3209777) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MEGF11 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MEGF11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MEGF11 megf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMMEELNPYT KISPALGAER HSVGAVTGIM LLLFLIVVLL GLFAWHRRRQ. It is sometimes possible for the material contained within the vial of "MEGF11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
