Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ITGB5 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Spleen)

Rabbit ITGB5 Polyclonal Antibody | anti-ITGB5 antibody

ITGB5 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITGB5; Polyclonal Antibody; ITGB5 antibody - middle region; anti-ITGB5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL
Sequence Length
799
Applicable Applications for anti-ITGB5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ITGB5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ITGB5 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-ITGB5 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Spleen)
Related Product Information for anti-ITGB5 antibody
This is a rabbit polyclonal antibody against ITGB5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligand.
Product Categories/Family for anti-ITGB5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
integrin beta-5 isoform a
NCBI Official Synonym Full Names
integrin subunit beta 5
NCBI Official Symbol
ITGB5
NCBI Protein Information
integrin beta-5
UniProt Protein Name
Integrin beta-5
Protein Family
UniProt Gene Name
ITGB5
UniProt Entry Name
ITB5_HUMAN

NCBI Description

This gene encodes a beta subunit of integrin, which can combine with different alpha chains to form a variety of integrin heterodimers. Integrins are integral cell-surface receptors that participate in cell adhesion as well as cell-surface mediated signaling. The alphav beta5 integrin is involved in adhesion to vitronectin. [provided by RefSeq, Aug 2017]

Uniprot Description

ITGB5: Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligand. Heterodimer of an alpha and a beta subunit. Beta-5 associates with alpha-V. Interacts with MYO10. Belongs to the integrin beta chain family.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q21.2

Cellular Component: focal adhesion; cell surface; leading edge; plasma membrane; phagocytic vesicle; receptor complex

Molecular Function: integrin binding; protein binding; receptor activity

Biological Process: integrin-mediated signaling pathway; antigen processing and presentation of peptide antigen via MHC class I; extracellular matrix organization and biogenesis; muscle contraction; transforming growth factor beta receptor signaling pathway; cell-matrix adhesion; stress fiber formation; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I

Research Articles on ITGB5

Similar Products

Product Notes

The ITGB5 itgb5 (Catalog #AAA3207695) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGB5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGB5 itgb5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFFTATCQDG VSYPGQRKCE GLKIGDTASF EVSLEARSCP SRHTEHVFAL. It is sometimes possible for the material contained within the vial of "ITGB5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.