Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human ACADSB Polyclonal Antibody | anti-ACADSB antibody

ACADSB Polyclonal Antibody

Gene Names
ACADSB; ACAD7; SBCAD; 2-MEBCAD
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
ACADSB; Polyclonal Antibody; ACADSB Polyclonal Antibody; 2-MEBCAD; ACAD7; SBCAD; anti-ACADSB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAGAGSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRDTPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIE
Sequence Length
330
Applicable Applications for anti-ACADSB antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human ACADSB
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion matrix
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-ACADSB antibody
Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-KDa.
Product Categories/Family for anti-ACADSB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
36
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa/47kDa
NCBI Official Full Name
short/branched chain specific acyl-CoA dehydrogenase, mitochondrial isoform 2
NCBI Official Synonym Full Names
acyl-CoA dehydrogenase short/branched chain
NCBI Official Symbol
ACADSB
NCBI Official Synonym Symbols
ACAD7; SBCAD; 2-MEBCAD
NCBI Protein Information
short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
UniProt Protein Name
Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
UniProt Gene Name
ACADSB
UniProt Synonym Gene Names
SBCAD; 2-MEBCAD; 2-methylbutyryl-CoA dehydrogenase

NCBI Description

Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-KDa. [provided by RefSeq, Jul 2008]

Uniprot Description

Has greatest activity toward short branched chain acyl-CoA derivative such as (s)-2-methylbutyryl-CoA, isobutyryl-CoA, and 2-methylhexanoyl-CoA as well as toward short straight chain acyl-CoAs such as butyryl-CoA and hexanoyl-CoA. Can use valproyl-CoA as substrate and may play a role in controlling the metabolic flux of valproic acid in the development of toxicity of this agent.

Research Articles on ACADSB

Similar Products

Product Notes

The ACADSB acadsb (Catalog #AAA9135005) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACADSB Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACADSB can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the ACADSB acadsb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASVAVFCEIQ NTLINTLIRK HGTEEQKATY LPQLTTEKVG SFCLSEAGAG SDSFALKTRA DKEGDYYVLN GSKMWISSAE HAGLFLVMAN VDPTIGYKGI TSFLVDRDTP GLHIGKPENK LGLRASSTCP LTFENVKVPE ANILGQIGHG YKYAIGSLNE GRIGIAAQML GLAQGCFDYT IPYIKERIQF GKRLFDFQGL QHQVAHVATQ LEAARLLTYN AARLLEAGKP FIKEASMAKY YASEIAGQTT SKCIE. It is sometimes possible for the material contained within the vial of "ACADSB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.