Peptide deformylase Recombinant Protein | def recombinant protein

Recombinant Staphylococcus aureus Peptide deformylase (def)

Cat. Num. AAA1086471

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Peptide deformylase; Recombinant Staphylococcus aureus Peptide deformylase (def); Polypeptide deformylase; def recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-183aa; Full Length
• Sequence: MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV
• Sequence Length: 183

• Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for def recombinant protein

Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

References

Staphylococcus aureus deformylase 1 encoding DNA.Lonetto M.A., Sylvester D.R., Warren R.L. Identification of Staphylococcus aureus proteins recognized by the antibody-mediated immune response to a biofilm infection.Brady R.A., Leid J.G., Camper A.K., Costerton J.W., Shirtliff M.E.Infect. Immun. 74:3415-3426(2006) Structure analysis of peptide deformylases from Streptococcus pneumoniae, Staphylococcus aureus, Thermotoga maritima and Pseudomonas aeruginosa snapshots of the oxygen sensitivity of peptide deformylase.Kreusch A., Spraggon G., Lee C.C., Klock H., McMullan D., Ng K., Shin T., Vincent J., Warner I., Ericson C., Lesley S.A.J. Mol. Biol. 330:309-321(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 446879781
• NCBI Accession #: WP_000957037.1
• NCBI GenBank Nucleotide #: WP_000957037.1
• UniProt Accession #: P68826; Q9F4L4
• Molecular Weight: 22.6 kDa
• NCBI Official Full Name: peptide deformylase
• UniProt Protein Name: Peptide deformylase
• Protein Family: Plectasin
• UniProt Gene Name: def
• UniProt Synonym Gene Names: def1; pdf1; PDF
• UniProt Entry Name: DEF_STAAU

Uniprot Description

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions ().